CAZyme Information: QRD87098.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD87098.1
• CAZy Family: GH16
• CAZyme Description: rhamnogalacturonase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
554		59011.32	4.5042

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044619:250378-252222(-)

Full Sequence      

MRSVSLFLWGLAPLLASAQLTGRVGPLKSAAEKAANKTCNVLDYGAVADLSTDIGQPLLD
AFEDCNGSGLVYVPEGEYALSTWVLFDKGESWALQLDGVIYRNGTDGGNMITFEHTSDFE
MFSSNGKGAIQALGYEFRNAGESTNTRIMRLQKVSSFSVHDIILVDSPAFHMSLDTVSDG
EVYNVVVRGGSSGGLDGIDVWGENVWIHDVEVTNKDECVTVKNPSHNLLIENVYCNWSGG
CAIGSITSGTNITDIIYRNVYTRSSNQMFMIKSNGGDGYVRNLALENFIGHGNAYSLDID
SAWSNIDTADGDGVEFSNITVSNWKGTEEDGVQRGPIKILCPDENPCYDITIKDFAMWTE
TGDSQTYFCQSAYGDGHCLQDGDELKEYTTTLTATSAPSGYAAPTMKEDLSEAMALNTSI
AIPTIPASFYPGVMPYSSIAGGSAAAVTPSSSVASPSVSATPSSSFVAWSSSVRVSSPSR
PASSPSSTRVSPSSSWIRTTGTPPTTASTDALPTIPAQKQPSPDTEVIGKCGFAPPPNQG
GHHHVHHHTAPQHH

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	65	372	6.2e-52	0.9538461538461539

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215540	PLN03010	3.87e-20	40	387	48	401	polygalacturonase
165802	PLN02155	5.52e-16	34	374	23	380	polygalacturonase
395231	Glyco_hydro_28	2.41e-15	147	370	86	313	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215426	PLN02793	2.47e-13	149	400	180	437	Probable polygalacturonase
178580	PLN03003	1.20e-10	40	364	25	364	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD87098.1|GH28	0.0	1	554	1	554
QMW26743.1|GH28	0.0	1	554	1	554
QMW38822.1|GH28	0.0	1	554	1	554
UCK59360.1|GH28	0.0	1	536	1	536
BAE55185.1|GH28	0.0	1	554	1	554

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	2.40e-199	19	441	1	422	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
4C2L_A	1.39e-11	46	365	23	368	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ARE6|RHGA_EMENI	1.39e-216	4	446	3	445	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|A2R3G4|RHGB_ASPNC	6.81e-215	10	451	13	455	Probable rhamnogalacturonase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgB PE=3 SV=1
sp|P87161|RHGB_ASPNG	9.66e-215	10	451	13	455	Rhamnogalacturonase B OS=Aspergillus niger OX=5061 GN=rhgB PE=1 SV=1
sp|A2QYE5|RHGA_ASPNC	2.60e-211	1	446	1	446	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|Q0CFC7|RHGB_ASPTN	5.54e-211	6	446	9	449	Probable rhamnogalacturonase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=rhgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999714	CS pos: 18-19. Pr: 0.9693

TMHMM  Annotations     

There is no transmembrane helices in QRD87098.1.