CAZyme Information: QRD87095.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD87095.1
• CAZy Family: GH16
• CAZyme Description: UDP-glucuronosyl and UDP-glucosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
851	CP044619|CGC3	94265.48	8.2288

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044619:240866-244034(+)

Full Sequence      

MAAATASPHRPREHGLTAGDWPDEHLSPRRRSVGGGHAHLREQGLDTGVRVMDDGRLDIK
FREHKPWLLNLIKHLERQPKPLPGERRPSVMSMEGQDKFPLRLNIVIHVVGSRGDVQPFV
ALGKELQKHGHRVRLATHLAFREYINETGLEFFSIGGDPAELMAFMVNNPGLMPDMRTIR
SGAIPKRRREMKAIFSGCWRSCFETGDGTGMHHIKEDPWSDAPDCNTQPFVADVIIANPP
SFAHLSCAEKLGIPVNMMFTMPWSATQSFPHPLANIRARNTKPSVANFASYAIVEVMLWE
GLGDLINRFRKRELGLDPLDAIRAPSIAHRLQIPYTYLWSPSLLPKPQDWGDNIDVCGFQ
FLESDTNYKPPDDLDAFLKAGDPPVYIGFGSIVVDNPAKLTEIVFEAVRLTGKRALVSKG
WGNIGEGRAEVPKDVMLLGKVPHDWLFQHVSCVVHHGGAGTTAAGLVLGRPTVIVPFFGD
QPFWGSIVARAGAGPQPVPYKQLTAEKLAEAINIALEPSTLEKAEEIGKGMRTERGVQNA
VCSFHQHLDLRSLRCAICPTRPAVWWHKHLHIKLSAFAAAVLVEAGIVDPHHFEFRQDRS
EGDNRSSISESDIESESDSDYASAEEEQSDSSSTNTVVDDSDEAANELDLERTLTRKRAK
EQKTGAQEILAETGYHTSKFAKQVLNFAIMLPTDLTLSLAKGFHNAPKLYHDTTVQRIPR
VRNVKSGFRAAGTEFTEGFYYGITGLLTQPARGFQKSGGRGLVKGVGKGVGGVFFKPAAG
IWGLAGFPLDGLHKSLRNSLTKNKTKYILRSRLEQGIQEMCAASMEERAIVMKKWRELEK
NHPQNQNGHAH

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	226	546	2.9e-61	0.756544502617801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.94e-89	103	547	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.51e-47	105	540	4	391	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	3.81e-19	105	270	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	6.67e-15	103	540	1	382	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
177858	PLN02208	3.62e-05	358	533	225	411	glycosyltransferase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD87095.1|GT1	0.0	1	851	1	851
BAE55182.1|GT1	0.0	1	851	1	851
QMW26747.1|GT1	0.0	1	851	1	947
QMW38826.1|GT1	0.0	1	851	1	947
UCK59363.1|GT1	0.0	1	851	1	947

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	9.31e-79	110	549	27	440	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.59e-78	110	549	47	460	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	5.31e-35	103	534	1	385	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	7.21e-33	103	534	1	368	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	9.17e-29	103	534	1	386	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	5.12e-131	84	548	170	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	3.41e-128	102	548	155	574	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	2.91e-79	81	548	1141	1609	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|Q5A950|ATG26_CANAL	9.30e-77	54	549	963	1434	Sterol 3-beta-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATG26 PE=3 SV=2
sp|A7KAK6|ATG26_PICAN	1.05e-75	110	549	795	1204	Sterol 3-beta-glucosyltransferase OS=Pichia angusta OX=870730 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QRD87095.1.