CAZyme Information: QRD87059.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD87059.1
• CAZy Family: GH16
• CAZyme Description: putative cutinase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
213		22263.42	6.4428

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044619:163904-164698(+)

Full Sequence      

MHLRNIVIALAATAVASPVDLQDRQLTGGDELRDGPCKPITFIFARASTEPGLLGISTGP
AVCNRLKLARSGDVACQGVGPRYTADLPSNALPEGTSQAAIAEAQGLFEQAVSKCPDTQI
VAGGYSQGTAVMNGAIKRLSADVQDKIKGVVLFGYTRNAQERGQIANFPKDKVKVYCAVG
DLVCLGTLIVAPPHFSYLSDTGDASDFLLSQLG

Enzyme Prediction     

EC	3.1.1.74:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	36	212	1.4e-40	0.9947089947089947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.10e-71	36	212	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW26781.1|CE5	9.17e-152	1	213	1	213
BAE55151.1|CE5|3.1.1.74	9.17e-152	1	213	1	213
QMW38860.1|CE5	9.17e-152	1	213	1	213
QRD87059.1|CE5	9.17e-152	1	213	1	213
UCK59401.1|CE5	9.17e-152	1	213	1	213

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GBS_A	1.69e-142	17	213	1	197	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	5.82e-134	26	212	1	187	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	2.90e-74	17	212	1	198	Chain A, cutinase [Malbranchea cinnamomea]
3DCN_A	3.91e-60	21	213	4	201	Glomerella cingulata apo cutinase [Colletotrichum gloeosporioides],3DD5_A Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_B Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_C Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_D Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_E Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_F Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_G Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_H Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DEA_A Glomerella cingulata PETFP-cutinase complex [Colletotrichum gloeosporioides],3DEA_B Glomerella cingulata PETFP-cutinase complex [Colletotrichum gloeosporioides]
1CUY_A	1.91e-58	20	212	9	207	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8MVS3|CUTI1_ASPFN	1.63e-152	1	213	1	213	Probable cutinase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_072700 PE=3 SV=1
sp|P52956|CUTI1_ASPOR	1.63e-152	1	213	1	213	Cutinase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=cutL PE=1 SV=1
sp|Q2TZY7|CUTI2_ASPOR	4.23e-118	1	212	1	212	Probable cutinase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000665 PE=3 SV=1
sp|B8NBB2|CUTI2_ASPFN	7.89e-118	1	212	1	212	Probable cutinase 2 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_044870 PE=3 SV=2
sp|B0Y537|CUTI2_ASPFC	1.17e-111	1	212	1	212	Probable cutinase 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_071270 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000485	0.999472	CS pos: 24-25. Pr: 0.7408

TMHMM  Annotations     

There is no transmembrane helices in QRD87059.1.