CAZyme Information: QRD86852.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD86852.1
• CAZy Family: GH154
• CAZyme Description: endo mannanase, GH76 family

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459		50991.21	4.4394

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044620:4809773-4811350(-)

Full Sequence      

MILFQLFARFLSLWLVLFCTPTAAIPLDVNDSESLKDAASTAARGMLKYYHGNEPGQTPG
TLDGTWWEAGAMFMTLVQYWRVSGDSSYNDLTTQGLQWQSGDDHDYLPANSSAYLGNDDQ
MFWGLAAMTCAESRYPDVSDGPSWLSLVQGVFNNQIPRWEMQTCHGGLRWQIHSWLPGYD
LKNTISNGGLFQIAARLARYTGDQKYADWATKIWDWIASSPLLDTKTWNVADTTSVTNDC
TTNGNEQWTYNYGTLLSGAAYMYNLTNGDQKWLDAVDGLLNASLRLFFPPMYNNGTVLSE
VSCETIETCDRNQMCFKGFLSIWMAYTATLVPSTAERIIPRLQGSAEAAARQCSGGEDGT
ACGVRWYEDKWDGRNGLETQMSSLSIFTANLMLQSDEQPVTSTTGGESKSDPDAGTGGKS
RKPEEPRKIKAGDRAGAWIMTLVVGVAWIVIIVWLVWEK

Enzyme Prediction     

No EC number prediction in QRD86852.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	33	401	4.8e-110	0.9581005586592178

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	0.0	34	384	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD86852.1|GH76	0.0	1	459	1	459
QMW30368.1|GH76	0.0	1	459	1	462
QMW42440.1|GH76	0.0	1	459	1	462
BAE59608.1|GH76	0.0	24	459	12	461
UDD62122.1|GH76	0.0	46	459	1	414

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	8.54e-99	29	434	30	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	3.13e-119	25	456	19	445	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	3.20e-114	16	456	12	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	1.92e-113	27	456	24	450	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q5AD78|DCW1_CANAL	2.04e-107	12	456	4	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	6.04e-104	10	415	6	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000220	0.999745	CS pos: 24-25. Pr: 0.9792

TMHMM  Annotations     

Start	End
435	457