CAZyme Information: QRD86028.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD86028.1
• CAZy Family: GH13
• CAZyme Description: Anp1-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	CP044620|CGC16	46832.03	6.3755

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044620:2408057-2409544(-)

Full Sequence      

MLLPKGGVTWKSAKARLPPWRAILVLVTRTRFLVSLALTGLLILLWRGISKSASEMQNFY
CYGPPKSPMDMSLNEMAEWNAHMQTPVVYNHHDPYEVNSSTIHNIDLNPIGSSAQAVANA
ERVLILTPLRDAGPYLQKYFELLYKLSYPHHLIDLAFLVGDSKDDTESLLVSELNRIQEQ
GDKVAFRSASIIKKDFGADVNMNVEDRHSFAAQGPRRKAIGRARNYLLYSALKPDHSWVY
WRDVDIVDSPETILQDFMAHDRDILVPNIWFHRYKDGVDVEGRFDYNSWIESDKGRRLRQ
TLDPDTVLAEGYKEYDTGRQYLVSMGDWRNNKDEEVELDGIGGVNILVKADVHRTGINFP
AYAFENQAETEGFARMAKRAGYQVYGLPNYVVWHIDTDEKPGNLGDRKAY

Enzyme Prediction     

No EC number prediction in QRD86028.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	99	362	2.2e-108	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	3.43e-153	101	363	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE59398.1|GT62	7.94e-311	1	410	1	410
QRD86028.1|GT62	7.94e-311	1	410	1	410
QMW29646.1|GT62	7.94e-311	1	410	1	410
QMW41718.1|GT62	7.94e-311	1	410	1	410
UDD58381.1|GT62	7.94e-311	1	410	1	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.61e-62	102	398	6	303	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	4.10e-93	98	395	58	355	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	1.92e-91	121	395	98	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	8.43e-77	100	395	170	512	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	4.65e-76	96	395	70	419	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	6.73e-65	102	396	73	367	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000004	0.000007

TMHMM  Annotations     

There is no transmembrane helices in QRD86028.1.