CAZyme Information: QRD85183.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD85183.1
• CAZy Family: GH106
• CAZyme Description: putative cutinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327		31187.20	8.4903

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044620:224392-225462(+)

Full Sequence      

MKAIAALALVGGAIAAPTKTVESRQLPGMGSLPGLGSSGSSTGSGLGSLASMLPGLGGSS
SGGSLPGLGSSTGSGLGSLASLIPGLGGSSSGSSLPGLGGSSLIPGLGGSSSSGSGIPGL
GSSTGNIPDLSSLLGGSSSGGLPGLTKRASITENGVTQNAGCQELTFIFARGTSEMGNMG
SVVGPPVAKQLASLTGNKVTVQGVDYPADAAGNANMGASGGPKMAELIQQAKKQCPNTKV
VVGGYSQGAMVVHNAASKVGADAISGAVLFGDPFKTQGVGQLASNKVKEFCASGDPVCLN
GMNFMAHLSYGSNAQEAAQFLVQAAGL

Enzyme Prediction     

No EC number prediction in QRD85183.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	162	323	2.3e-46	0.9788359788359788

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	4.72e-45	162	324	2	172	Cutinase.
223477	YpfH	0.002	223	327	82	177	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD85183.1|CE5	1.21e-190	1	327	1	327
QMW41006.1|CE5	2.69e-188	1	327	1	331
QMW28931.1|CE5	2.69e-188	1	327	1	331
UDD59214.1|CE5	1.47e-174	1	327	1	343
BAE58644.1|CE5	2.84e-119	140	327	30	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	3.49e-32	149	322	66	244	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
3GBS_A	1.11e-25	162	326	21	197	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	8.85e-25	162	322	12	184	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	1.20e-22	162	321	23	194	Chain A, cutinase [Malbranchea cinnamomea]
4OYY_A	5.54e-22	153	321	6	188	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VJF5|CUTI4_EMENI	1.32e-81	148	327	46	223	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	5.17e-36	162	327	31	202	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	2.10e-34	149	326	18	200	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|A8QPD8|CUTI1_TRIHA	7.57e-33	157	321	74	243	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1
sp|Q8X1P1|CUTI_BLUHO	1.54e-32	149	322	55	233	Cutinase OS=Blumeria hordei OX=2867405 GN=CUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000274	0.999726	CS pos: 24-25. Pr: 0.8824

TMHMM  Annotations     

There is no transmembrane helices in QRD85183.1.