CAZyme Information: QRD85043.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD85043.1
• CAZy Family: GH1
• CAZyme Description: putative unsaturated glucuronyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	CP044621|CGC30	47032.76	5.5191

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044621:4383781-4385329(-)

Full Sequence      

MATMARFKATILSSVLLPLLLSSHGAAVPSPPSCNADTRPYSAWMADSVISRGQAVLPSG
TTPEASTFLQIGVFQNAILQLKEYYGSPENACAQADWDAYLEESTQSVTPWLLNATKDTQ
YPLDRFSDGNGLFYQYERTDNETYKAALDALQQSIYLQPKNKYGGYWYFKYPNWSYLDGM
YSLIPFYSTYTARFAAENSSAVGKDLVYQLDLLWSHCHQNNTGLLVHGYDASKTAVWANP
ATGGSPIVWIRSLGWYMMALVDILEISRQQGVLNQEQWNHVHQQFVALSNAVMAAADPET
GCWWQVMTDPNRKGNYIESSGSAMFTYALYKGARLGLLHGIPEEALLPASLASKCYSHLL
QDFVVDNKNGTLGYNGTVSVCSLSSNATYEYYVHQPLLYNSLHGTSSFILASVEHERATN
VSGN

Enzyme Prediction     

No EC number prediction in QRD85043.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	70	417	1.4e-75	0.9518072289156626

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	7.13e-44	111	418	67	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	1.89e-42	45	417	5	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD85043.1|GH105	0.0	1	424	1	424
UDD61061.1|GH105	1.35e-317	1	424	1	424
BAE63195.1|GH105	3.98e-310	1	424	1	419
QMW45474.1|GH105	3.30e-309	7	424	505	922
QMW33436.1|GH105	3.30e-309	7	424	505	922

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	4.43e-51	113	416	64	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.21e-39	123	416	87	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.32e-39	123	416	77	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	1.14e-38	123	416	87	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	4.62e-28	223	414	38	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	4.62e-28	223	414	38	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000782	0.999202	CS pos: 25-26. Pr: 0.9605

TMHMM  Annotations     

There is no transmembrane helices in QRD85043.1.