CAZyme Information: QRD84523.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD84523.1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537	CP044621|CGC2	61550.43	5.1173

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044621:2969026-2970639(-)

Full Sequence      

MLKNNSFNNSPKMPIFRTRTVFPLIALFSIGFFFWCIERYDRAAFLRFKHPVDRVTTSAG
TPQIQLQPSSAPTAKMCDADPSVMPPLPFTEWLPRKNYTRAYFRPHHVSPKTEFSSLEEI
DIPVLPPMTVMERGMVVSPDNEDEDISCPPIIDVNVAADHDVDETDKLLFGLATTADRLD
RLLPSLLYSYGNTKAGIIVLVPESDDDIPKQETYFRNRGLDLTLIQSPLDFTARYFGLVE
AFANHIRTKRPQTQWVSFIDDDTFWLSLPTVAEELKLFDVTKKHYIGSLSEAHWQVDTFG
HIAFGGAGVFVSKPLLDVLEEYYDECQSWGEQPGDQKLGQCIQRYGDTPLTLWPSLYQMD
MKGEVDGVYESGRKIESLHHWNSWYTKDVVKMTTVAAAAGRRSVLRRWVFDQEEIVNNST
GKSTRTFWVFTNGYSLVKYTYGENTPDDAIDFDHTEKTWEEDPRGYEERLGPLRPKEHDG
VLKDRWLLREAYVVGDNVHQWYVREEDEGHSVIEIVWLGPKGGGGAGIKDYNVRKHH

Enzyme Prediction     

EC	2.4.1.-:2

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	8.00e-11	238	407	200	375	hypothetical protein; Provisional
367085	Fringe	0.002	255	358	87	203	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	0.002	303	397	10	106	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE62723.1|GT31	0.0	1	537	1	537
QRD84523.1|GT31	0.0	1	537	1	537
UDD58055.1|GT31	0.0	1	537	1	537
QMW32971.1|GT31	0.0	13	537	1	525
QMW45004.1|GT31	0.0	13	537	1	525

PDB Hits     

QRD84523.1 has no PDB hit.

Swiss-Prot Hits     

QRD84523.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000005

TMHMM  Annotations     

Start	End
20	37