CAZyme Information: QRD84419.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD84419.1
• CAZy Family: CE12
• CAZyme Description: putative rhamnogalacturonase A precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454		48473.54	4.1121

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044621:2722739-2724289(+)

Full Sequence      

MHVVSMRSKTFSVLSSCLLLIATVQGQLSGSVGPSTSISDKKAVKTCNVLDYGATNDNKT
DVGQPIMDAFEDCGSGGVIYIPDGDYLIQEWVSLENGTAFAIQLDGVIYRNGTTTSQGYM
FGISGGSDFELYSSTSKGAIQGSGYLYHMNGEFTAPRLLHISDVSHWSVHDIALVDAPMF
HFVIDDASNGEVYNMAIRGGNSGGLDGIDVSGDNIWIHDVMVTNKDECVTVKTGSHNFQI
ENIYCNWSGGCAMGSLGSGTNVSNIVYRNIYTWNSNQMYMIKSNGGDGEVSNLLFENFIG
HGNAYSLDLDSEWSSMDTVDGDGIFYRNITFKNWKGTETDGESRPSIRVICPEATPCTDI
TIEDVDLWTEEGDSETYVCKNAFGSGACLKSDSSSTATYATTTTVTSAPSGYSATTMAAD
LTSAFGTDASIPIPTIPTSFYPGATPYSALAGSS

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	73	382	1.2e-56	0.9538461538461539

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215540	PLN03010	1.86e-22	48	387	48	394	polygalacturonase
395231	Glyco_hydro_28	1.32e-19	154	388	83	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	6.20e-18	42	382	63	418	polygalacturonase ADPG
215120	PLN02188	1.84e-16	18	382	9	390	polygalacturonase/glycoside hydrolase family protein
215426	PLN02793	5.11e-16	10	385	14	412	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD84419.1|GH28	0.0	1	454	1	454
UDD57956.1|GH28	0.0	1	454	1	454
QMW32887.1|GH28	0.0	6	454	1	449
QMW44915.1|GH28	0.0	6	454	1	449
BAE62561.1|GH28	3.61e-308	6	454	1	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	3.18e-210	27	452	1	422	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
1K5C_A	1.73e-07	206	268	153	214	Endopolygalacturonase I from Stereum purpureum at 0.96 A resolution [Chondrostereum purpureum],1KCC_A Endopolygalacturonase I from Stereum purpureum complexed with a galacturonate at 1.00 A resolution. [Chondrostereum purpureum],1KCD_A Endopolygalacturonase I from Stereum purpureum complexed with two galacturonate at 1.15 A resolution. [Chondrostereum purpureum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NKB9|RHGE_ASPFN	0.0	6	454	1	449	Probable rhamnogalacturonase E OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgE PE=3 SV=2
sp|Q2U7A4|RHGE_ASPOR	6.42e-309	6	454	1	432	Probable rhamnogalacturonase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgE PE=3 SV=1
sp|Q1ZZM3|RHGE_ASPNG	1.16e-237	20	454	16	450	Probable rhamnogalacturonase E OS=Aspergillus niger OX=5061 GN=rhgE PE=3 SV=1
sp|Q00001|RHGA_ASPAC	4.70e-211	22	452	14	440	Rhamnogalacturonase A OS=Aspergillus aculeatus OX=5053 GN=rhgA PE=1 SV=1
sp|A2QYE5|RHGA_ASPNC	1.11e-208	24	454	16	443	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000248	0.999686	CS pos: 26-27. Pr: 0.9771

TMHMM  Annotations     

There is no transmembrane helices in QRD84419.1.