CAZyme Information: QRD83422.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD83422.1
• CAZy Family: AA7
• CAZyme Description: FMN-dependent dehydrogenase-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
715	CP044621|CGC19	80264.24	6.1195

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044621:39985-43086(-)

Full Sequence      

MNKIFTSAEVAHHNKENSCWVVLYGKVYDVTHFLSSHPGGAQAILRVSGRDATDDFDPIH
PPETMDSIQSALIGSLSLDEKSSCATQTTDTSDEIDVSTLLNLDEIEKAATNVISKKAWA
YYYSAADDKITKDFNTQVYRSLLLRPRVFVDCRKCDVETELLGWKVGLPIYVSPTAMARL
GHPRGEAGIAEACGAFGALQIIASNSSLSPEQVVAKALPTQVFGWQLYVQLDRRASEAML
ARVNRLDEIKFVILTLDAPVSGKREDDERINVKSNPAGSVSAQLFAGTDPSLTWNETLEW
LSRHTKKPIILKGLQTHEDVAIAARYTPLVQAVILSNHGGRSLDTAPPAVHTLLEAQKYC
PHVFKKMEVWVDGGIRRDSSACLDSSQPHFDPNEQKKFAKPRIVIPPRKMGKKRILVGYG
VDIDAVAGWLGSYGGEDSVSDISRGLWAGHIGTPRLLKLFEKYNIKASWFIPGHTLETFP
EECAQVRDAGHEIGLHGYSHENPASMTLEQQRDILDKTYKMLRDFCGKPPRGIVAPWWEA
SAEMVELLLAYGIEYDHSMSHEDCQMYWLRTGDSWTKIDYSQKAETWMKPLVRGQTTGLV
EIPGSWYIDDLPPMMFIKNSANSHGWVNPRDVEAIWKDHFDYFYREYDEFVFPMTIHPDV
SGRPHVLLMHERIIEHINKHEGVEWVTFEQMCDEFKKKNQPPPGAPMPAAADSVL

Enzyme Prediction     

No EC number prediction in QRD83422.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	454	558	1.7e-20	0.7846153846153846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
200563	CE4_HpPgdA_like	6.05e-128	417	696	2	258	Catalytic domain of Helicobacter pylori peptidoglycan deacetylase (HpPgdA) and similar proteins. This family is represented by a peptidoglycan deacetylase (HP0310, HpPgdA) from the gram-negative pathogen Helicobacter pylori. HpPgdA has the ability to bind a metal ion at the active site and is responsible for a peptidoglycan modification that counteracts the host immune response. It functions as a homotetramer. The monomer is composed of a 7-stranded barrel with detectable sequence similarity to the 6-stranded barrel NodB homology domain of polysaccharide deacetylase (DCA)-like proteins in the CE4 superfamily, which removes N-linked or O-linked acetyl groups from cell wall polysaccharides. In contrast to typical NodB-like DCAs, HpPgdA does not exhibit a solvent-accessible polysaccharide binding groove, suggesting that the enzyme binds a small molecule at the active site.
239238	FCB2_FMN	6.82e-126	104	377	1	282	Flavocytochrome b2 (FCB2) FMN-binding domain. FCB2 (AKA L-lactate:cytochrome c oxidoreductase) is a respiratory enzyme located in the intermembrane space of fungal mitochondria which catalyzes the oxidation of L-lactate to pyruvate. FCB2 also participates in a short electron-transport chain involving cytochrome c and cytochrome oxidase which ultimately directs the reducing equivalents gained from L-lactate oxidation to oxygen, yielding one molecule of ATP for every L-lactate molecule consumed. FCB2 is composed of 2 domains: a C-terminal flavin-binding domain, which includes the active site for lacate oxidation, and an N-terminal b2-cytochrome domain, required for efficient cytochrome c reduction. FCB2 is a homotetramer and contains two noncovalently bound cofactors, FMN and heme per subunit.
395850	FMN_dh	8.30e-83	110	377	1	284	FMN-dependent dehydrogenase.
239203	alpha_hydroxyacid_oxid_FMN	3.18e-65	104	377	1	238	Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO). In green plants, glycolate oxidase is one of the key enzymes in photorespiration where it oxidizes glycolate to glyoxylate. LMO catalyzes the oxidation of L-lactate to acetate and carbon dioxide. MDH oxidizes (S)-mandelate to phenylglyoxalate. It is an enzyme in the mandelate pathway that occurs in several strains of Pseudomonas which converts (R)-mandelate to benzoate.
213021	CE4_PuuE_HpPgdA_like	1.29e-58	417	690	2	243	Catalytic domain of bacterial PuuE allantoinases, Helicobacter pylori peptidoglycan deacetylase (HpPgdA), and similar proteins. This family is a member of the very large and functionally diverse carbohydrate esterase 4 (CE4) superfamily. It contains bacterial PuuE (purine utilization E) allantoinases, a peptidoglycan deacetylase from Helicobacter pylori (HpPgdA), Escherichia coli ArnD, and many uncharacterized homologs from all three kingdoms of life. PuuE allantoinase appears to be metal-independent and specifically catalyzes the hydrolysis of (S)-allantoin into allantoic acid. Different from PuuE allantoinase, HpPgdA has the ability to bind a metal ion at the active site and is responsible for a peptidoglycan modification that counteracts the host immune response. Both PuuE allantoinase and HpPgdA function as a homotetramer. The monomer is composed of a 7-stranded barrel with detectable sequence similarity to the 6-stranded barrel NodB homology domain of polysaccharide deacetylase (DCA)-like proteins in the CE4 superfamily, which removes N-linked or O-linked acetyl groups from cell wall polysaccharides. However, in contrast with the typical DCAs, PuuE allantoinase and HpPgdA might not exhibit a solvent-accessible polysaccharide binding groove and only recognize a small substrate molecule. ArnD catalyzes the deformylation of 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol to 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQD84776.1|CE4	2.21e-23	417	692	18	267
QIG53541.1|CE4	5.30e-17	440	699	57	287
ASJ91006.1|CE4	7.14e-16	452	695	62	277
SDS90788.1|CE4	7.97e-16	440	699	57	288
AOL24731.1|CE4	1.08e-15	440	695	57	284

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QBU_A	1.66e-138	405	699	29	322	Crystal structure of putative peptidoglycan deactelyase (HP0310) from Helicobacter pylori [Helicobacter pylori G27],3QBU_B Crystal structure of putative peptidoglycan deactelyase (HP0310) from Helicobacter pylori [Helicobacter pylori G27],3QBU_C Crystal structure of putative peptidoglycan deactelyase (HP0310) from Helicobacter pylori [Helicobacter pylori G27],3QBU_D Crystal structure of putative peptidoglycan deactelyase (HP0310) from Helicobacter pylori [Helicobacter pylori G27],4LY4_A Crystal structure of peptidoglycan deacetylase (HP0310) with Zinc from Helicobacter pylori [Helicobacter pylori G27],4LY4_B Crystal structure of peptidoglycan deacetylase (HP0310) with Zinc from Helicobacter pylori [Helicobacter pylori G27],4LY4_C Crystal structure of peptidoglycan deacetylase (HP0310) with Zinc from Helicobacter pylori [Helicobacter pylori G27],4LY4_D Crystal structure of peptidoglycan deacetylase (HP0310) with Zinc from Helicobacter pylori [Helicobacter pylori G27]
1SZE_A	5.78e-70	1	377	6	414	Chain A, Cytochrome b2, mitochondrial [Saccharomyces cerevisiae],1SZE_B Chain B, Cytochrome b2, mitochondrial [Saccharomyces cerevisiae]
1LTD_A	7.11e-70	1	377	1	409	The 2.6 Angstroms Refined Structure Of The Escherichia Coli Recombinant Saccharomyces Cerevisiae Flavocytochrome B2-Sulphite Complex [Saccharomyces cerevisiae],1LTD_B The 2.6 Angstroms Refined Structure Of The Escherichia Coli Recombinant Saccharomyces Cerevisiae Flavocytochrome B2-Sulphite Complex [Saccharomyces cerevisiae]
1FCB_A	8.04e-70	1	377	6	414	Molecular Structure Of Flavocytochrome B2 At 2.4 Angstroms Resolution [Saccharomyces cerevisiae],1FCB_B Molecular Structure Of Flavocytochrome B2 At 2.4 Angstroms Resolution [Saccharomyces cerevisiae],1KBI_A Crystallographic Study of the Recombinant Flavin-binding Domain of Baker's Yeast Flavocytochrome b2: Comparison with the Intact Wild-type Enzyme [Saccharomyces cerevisiae],1KBI_B Crystallographic Study of the Recombinant Flavin-binding Domain of Baker's Yeast Flavocytochrome b2: Comparison with the Intact Wild-type Enzyme [Saccharomyces cerevisiae]
1SZF_A	2.16e-69	1	377	6	414	Chain A, Cytochrome b2, mitochondrial [Saccharomyces cerevisiae],1SZF_B Chain B, Cytochrome b2, mitochondrial [Saccharomyces cerevisiae],1SZG_A Chain A, Cytochrome b2, mitochondrial [Saccharomyces cerevisiae],1SZG_B Chain B, Cytochrome b2, mitochondrial [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8MKR3|CYB2_TALSN	1.49e-155	1	377	1	409	L-lactate dehydrogenase (cytochrome) OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=TSTA_043820 PE=1 SV=1
sp|B5ZA76|PGDAE_HELPG	2.67e-138	413	699	3	289	Peptidoglycan deacetylase OS=Helicobacter pylori (strain G27) OX=563041 GN=pgdA PE=1 SV=1
sp|O25080|PGDAE_HELPY	4.80e-136	413	699	3	289	Peptidoglycan deacetylase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=pgdA PE=1 SV=1
sp|P09437|CYB2_WICAO	1.75e-69	10	377	88	473	L-lactate dehydrogenase (cytochrome) OS=Wickerhamomyces anomalus OX=4927 GN=CYB2 PE=1 SV=2
sp|P00175|CYB2_YEAST	2.58e-68	1	377	86	494	L-lactate dehydrogenase (cytochrome) OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYB2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QRD83422.1.