CAZyme Information: QRD83268.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD83268.1
• CAZy Family: AA7
• CAZyme Description: glycoside hydrolase superfamily

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
880	CP044622|CGC23	99090.07	7.0740

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044622:5948013-5950704(+)

Full Sequence      

MYLRGILSALAVLPFGIASVTSPGDTAVIPGWHLQSALHAPSNLTDLSLPTAHNVSAWYR
ISSRATVMAGLIQNHVYNDTHLFYSNNLATVDQTIFRAPWLYREELRLLAPPKGQHMFLI
THGITSKADIYFNGKQIASNATQQGSYGGHRYDITPFVRTGKNVLLIQAHPTNYLRDFAQ
GFVDWNPYPPDNGTGVWRDVELKQTGPVSMSSPRILTDFIGVHTENVTATIKVDIKNHED
RIANGVVHGTVQAQDKGSQTVAFSKQFKLEPYKNATVSIDVVLKNPKIWWPATWGKQPLY
TVKAKTTVGQNEISDIAPPTQFGIRHVTSKLNSYNDTEFSVNGYPFHVRGGGYSPDMFLR
FDLEHLRNIFRYMLDMGLNTVRLEGKQEHPELYDLADRMGLMVMSGWECCDKWEGWKYNN
EANGVKWTEKDYPIAETTMLHEAEMMQAHPSMLAFLIGSDFWPDEKATNVYVNALNRMDW
PNPIIASASKRGYPKLLGPSGMKMDGPYDWVPPNYWYHDKLGAAFGFGSEQGPGVGTPEL
GSLQQFMSAQELESLWMKPEQPQWHMAKNDSPFADRSLYNEGLFARYGPPTGLEDYLRKS
QMSDYEGTRAEFEAFAIRQNASRPATGVVYWMLNGAWPSLHWQLFDYYLRPAGSYFGTKV
GARLEHVAYDYEAHTVHIINHSLKNFGKRNVTVDLIDLNGTSMHHESIATYTTPTSSKQV
ATVPEINKIKDVGFLRLTLKDSVKGTTISRNVYWLPPNTESLDWDNSTFYTTPVTKYTDL
TALNKMPAANVSTSMKMTVSKHGSTFGEVTLENKSDVPAFFMHLTVSDENGHELAPVYWS
DNYVTLFPREKLILTVEFQGRKWAATLSGANVEKRGIGRS

Enzyme Prediction     

EC	3.2.1.165:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	79	723	1.3e-60	0.6436170212765957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408168	Ig_GlcNase	1.84e-38	769	872	1	104	Exo-beta-D-glucosaminidase Ig-fold domain. This domain can be found in 2 glycoside hydrolase subfamily of beta-glucosaminidases (EC:3.2.1.165) such as CsxA, from Amycolatopsis orientalis that has exo-beta-D-glucosaminidase (exo-chitosanase) activity. It has an immunoglobulin-like topology.
225789	LacZ	1.88e-21	92	460	57	406	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	9.57e-15	102	403	69	352	beta-D-glucuronidase; Provisional
236673	ebgA	8.47e-10	122	461	133	452	cryptic beta-D-galactosidase subunit alpha; Reviewed
395572	Glyco_hydro_2	2.11e-09	208	325	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD83268.1|GH2	0.0	1	880	1	880
QMW28734.1|GH2	0.0	1	880	1	880
QMW40806.1|GH2	0.0	1	880	1	880
UDD56792.1|GH2	0.0	1	880	1	880
BAE58464.1|GH2	0.0	1	880	1	880

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VZS_A	3.75e-190	24	871	49	890	Chitosan Product complex of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZS_B Chitosan Product complex of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2X05_A Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X05_B Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X09_A Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X09_B Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis]
2VZO_A	1.47e-189	24	871	49	890	Crystal structure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZO_B Crystal structure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis]
2VZT_A	2.93e-189	24	871	49	890	Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZT_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZV_A Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis],2VZV_B Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis]
2VZU_A	8.98e-188	24	871	49	890	Complex of Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZU_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis]
6BYG_A	7.76e-26	31	650	11	658	Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUH1|EBDG_ARTBC	0.0	20	875	29	880	Exo-beta-D-glucosaminidase ARB_07888 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07888 PE=1 SV=1
sp|Q4R1C4|EBDG_HYPJE	1.29e-308	9	873	7	886	Exo-beta-D-glucosaminidase OS=Hypocrea jecorina OX=51453 GN=gls93 PE=1 SV=1
sp|C0LRA7|EBDG_HYPVI	1.12e-306	9	866	7	886	Exo-beta-D-glucosaminidase OS=Hypocrea virens OX=29875 GN=gls1 PE=2 SV=1
sp|Q82NR8|EBDG_STRAW	4.62e-198	21	859	46	878	Exo-beta-D-glucosaminidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=csxA PE=1 SV=1
sp|Q56F26|EBDG_AMYOR	1.37e-189	24	871	49	890	Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis OX=31958 GN=csxA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000589	0.999381	CS pos: 18-19. Pr: 0.9654

TMHMM  Annotations     

There is no transmembrane helices in QRD83268.1.