CAZyme Information: QRD81719.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD81719.1
• CAZy Family: AA3
• CAZyme Description: beta-mannosidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1143	CP044622|CGC31	127669.43	5.8276

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044622:1503994-1508164(+)

Full Sequence      

MRFTATAAALVASSIPATLGQHVRDLSNEKWTLSSDALNHTVPGNLPSHAHLDLLKAGVI
GEYHGLNDFNLRIFEFCGKYVASTNNQYRQYSFDVSQILEGCNEDPILKIDFGSAPNIVN
AIAEDRNSPVWPDGIQQTYEYPNRWFMRKEQSDFGWDWGPAFAPAGPWKPAYIVQLPKAQ
NIHVLNTDLDIYRKGQINHLPPDQSQPWVVNASIDFVGSLPPNPSMSIEFKDTKSGEILT
SKRIGNVTVSGNSVTGVTVLGGVTPKLWWPLGLGDQNLYNITVTVTGHQNQTLAHVTKRT
GFRTIFLNQRNITDAQLAQGIAPGANWHFEVNGHEFYAKGSNIIPPDAFWPRVTEARMAR
LFDAVVAGNQNMLRVWSSGIYLHDFIYDLADERGILLWSEFEFSDALYPVDDAFLDNIAA
EVVYNVRRVNHHPSLALWAGGNEIESLMLPTVERKAPEEYAKYVGEYEKLYISLILPLVY
QNTRSITYSPSSTTEGYLDVDLSAPVPMVERYHNTTPGSYYGDTDFYNYDSSVSFNSHVY
PVGRFANEFGYHSMPSLQTWQQAVDPEDLHFNSTTVMLRNHHYPAGGTFTDNFHNTSLGM
GEMTIAVQRYYPIPNKLDSVANFSAWCHATQLFQADMYKSEIQFYRRGSGMPERQLGSLY
WQLEDIWQAPSWAGIEYGGRWKVLHYVSRDIYQRIIVSPFWNYTTGDLDLYVTSDLWESA
KGKVNLTWLDLSGTPLPHNAGTPGSVPFNVGALNTTKIYSTNIKNLTLPNPKDAILVLSL
SGEGHLPNSDKKTTFTHQNHFTPVFPKDLALVDPGLELSYNTKSKTFTVEAKSGVSLYTW
LDYPADVVGYFDENAFVLLPGQKKEIGFTVQEDNTDGKWNHVELAGIIMVIVSSSKKHAL
PENLPIVLSGRYFTQDIFLTCLAFWTGITAVTAYSPVLLSQAGYSKIKLNGLTGGLNTIG
ITGIIISAQIVDRLGRRRCLMLGSAMLFAVEIVAGSIYECSLRHPDKATQYAPGAVAMLF
QFNLGHAAPWGTVSFLIPTEIFPSDLRVQGKGFGITGWAIGVGMTTLVNSIMFYSIKSRS
YFLLAGLNLLWIPVVYFFYPETCNRSLESIEALLSTPSPFFWDMERSYGLHGDVLVERGG
EED

Enzyme Prediction     

EC	3.2.1.25:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	78	728	1.6e-66	0.5465425531914894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.16e-43	12	689	1	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
395036	Sugar_tr	2.99e-26	891	1114	227	452	Sugar (and other) transporter.
273317	SP	5.05e-23	887	1110	248	481	MFS transporter, sugar porter (SP) family. This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
340914	MFS_HXT	1.01e-20	879	1113	171	402	Fungal Hexose transporter subfamily of the Major Facilitator Superfamily of transporters and similar proteins. The fungal hexose transporter (HXT) subfamily is comprised of functionally redundant proteins that function mainly in the transport of glucose, as well as other sugars such as galactose and fructose. Saccharomyces cerevisiae has 20 genes that encode proteins in this family (HXT1 to HXT17, GAL2, SNF3, and RGT2). Seven of these (HXT1-7) encode functional glucose transporters. Gal2p is a galactose transporter, while Rgt2p and Snf3p act as cell surface glucose receptors that initiate signal transduction in response to glucose, functioning in an induction pathway responsible for glucose uptake. Rgt2p is activated by high levels of glucose and stimulates expression of low affinity glucose transporters such as Hxt1p and Hxt3p, while Snf3p generates a glucose signal in response to low levels of glucose, stimulating the expression of high affinity glucose transporters such as Hxt2p and Hxt4p. Schizosaccharomyces pombe contains eight GHT genes (GHT1-8) belonging to this family. Ght1, Ght2, and Ght5 are high-affinity glucose transporters; Ght3 is a high-affinity gluconate transporter; and Ght6 high-affinity fructose transporter. The substrate specificities for Ght4, Ght7, and Ght8 remain undetermined. The HXT subfamily belongs to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
340919	MFS_STP	1.54e-14	925	1101	213	390	Plant Sugar transport protein subfamily of the Major Facilitator Superfamily of transporters. The plant Sugar transport protein (STP) subfamily includes STP1-STP14; they are also called hexose transporters. They mediate the active uptake of hexoses such as glucose, 3-O-methylglucose, fructose, xylose, mannose, galactose, fucose, 2-deoxyglucose and arabinose, by sugar/hydrogen symport. Several STP family transporters are expressed in a tissue-specific manner, or at specific developmental stages. STP1 is the member with the highest expression level of all members and high expression is detected in photosynthetic tissues, such as leaves and stems, while roots, siliques, and flowers show lower expression levels. It plays a major role in the uptake and response of Arabidopsis seeds and seedlings to sugars. The STP subfamily belongs to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD81719.1|GH2	0.0	1	1143	1	1143
QMW39414.1|GH2	0.0	1	1143	1	1134
QMW27343.1|GH2	0.0	1	1143	1	1134
BAE57065.1|GH2	0.0	1	879	1	898
UDD55193.1|GH2	0.0	147	879	1	733

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CVU_A	0.0	23	879	30	927	Structure of Fungal beta-mannosidase from Glycoside Hydrolase Family 2 of Trichoderma harzianum [Trichoderma harzianum],4UOJ_A Chain A, BETA-MANNOSIDASE GH2 [Trichoderma harzianum],4UOJ_B Chain B, BETA-MANNOSIDASE GH2 [Trichoderma harzianum]
6DDT_A	3.84e-96	31	859	18	836	mouse beta-mannosidase (MANBA) [Mus musculus],6DDU_A mouse beta-mannosidase bound to beta-D-mannose (MANBA) [Mus musculus]
2VJX_A	5.53e-65	31	869	15	817	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	5.67e-65	31	869	17	819	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	5.75e-65	31	869	17	819	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UN00|MANBA_ASPOR	0.0	1	879	1	898	Beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndA PE=3 SV=1
sp|B8NP78|MANBA_ASPFN	0.0	1	879	1	898	Beta-mannosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndA PE=3 SV=1
sp|O74168|MANBA_ASPAC	0.0	17	881	20	923	Beta-mannosidase A OS=Aspergillus aculeatus OX=5053 GN=mndA PE=1 SV=1
sp|Q0CI48|MANBA_ASPTN	0.0	9	879	10	916	Beta-mannosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndA PE=3 SV=2
sp|Q5BCI8|MANBA_EMENI	0.0	9	879	10	910	Beta-mannosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000300	0.999676	CS pos: 20-21. Pr: 0.9783

TMHMM  Annotations     

Start	End
917	939
951	970
980	1002
1015	1037
1052	1074
1081	1100