CAZyme Information: QRD81270.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD81270.1
• CAZy Family: AA1
• CAZyme Description: putative rhamnogalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571	CP044622|CGC4	62893.63	4.1452

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

• Gene Location: location=CP044622:293379-295094(+)

Full Sequence      

MLFPTLVVTAAFAGGTLALPTGDDAPFLKVVSSTEAIVGNSIWNATVGASVVKPIYYQGK
EIVGDAKGQYYSYVDQTESFNFSNATIVDSDDDFIDVQFTTSEGEQHWVIYRNQHGAYQY
FINKALPSPLGEWRSVSRLDNATFTNGHTTYRQGALPELSEIESGEKVQDETWELSDGSY
ITKYDWSDFINSAKAWGVYGDGIGCWYIHPSKEYINGDHLKQELMLHRESSSGDTVLLNM
IHGLHFLTGEEHEFAEGRVWGPWLWYLNNGSVEDANAKYDEEVQSWPYSFPNADIEAGHH
QRASSVSGVITLSDGRAASGASVMLGDNESSQLPAEQGVNYYYRTTADSDGNFSFENVRA
ATYALYAWAGNNSDIGDVSTNLTANGIEISESTSAIDLGEYTWDAQNRTKIWQIGTLDRL
ACSFKNGCSGYHHGLSDESPADLEYTINSSETSNWSYVQTAEGTWQVKFELSDDPASDAV
AILSTSLAGYSSGVNIEITAQGGNVTVGELSDLTNDPSVYRSSTFCGLHRYEEFEVPAGT
LVKGSNTIEFTVTKTSQWHGFMWDSILLEWS

Enzyme Prediction     

No EC number prediction in QRD81270.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	36	555	1.2e-263	0.9942196531791907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199907	RGL4_N	7.26e-48	30	275	4	264	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405384	CBM-like	1.54e-42	411	568	2	157	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.
199905	RGL4_C	3.21e-27	412	569	1	161	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199904	RGL4_M	7.04e-13	305	399	4	90	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405387	fn3_3	4.99e-08	317	370	4	54	Polysaccharide lyase family 4, domain II. FnIII-like is domain II of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain displays an immunoglobulin-like or more specifically Fibronectin-III type fold and shows highest structural similarity to the C-terminal beta-sandwich subdomain of the pro-hormone/propeptide processing enzyme carboxypeptidase gp180 from duck. It serves to assist in producing the deep pocket, with domain III, into which the substrate fits.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW39028.1|PL4_5	0.0	1	571	1	571
QMW26948.1|PL4_5	0.0	1	571	1	571
QRD81270.1|PL4_5	0.0	1	571	1	571
BAE64494.1|PL4_5	0.0	1	571	1	571
UDD54757.1|PL4_5	0.0	1	571	1	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NJX_A	1.15e-06	93	556	67	489	Rhamnogalacturonan Lyase from Aspergillus aculeatus mutant H210A [Aspergillus aculeatus]
1NKG_A	2.01e-06	93	556	67	489	Rhamnogalacturonan lyase from Aspergillus aculeatus [Aspergillus aculeatus]
2XHN_A	2.65e-06	93	556	67	489	Rhamnogalacturonan lyase from Aspergillus aculeatus K150A active site mutant [Aspergillus aculeatus],2XHN_B Rhamnogalacturonan lyase from Aspergillus aculeatus K150A active site mutant [Aspergillus aculeatus],3NJV_A Rhamnogalacturonan lyase from Aspergillus aculeatus K150A substrate complex [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8RJP2|RHIE_DICD3	2.43e-52	94	548	113	557	Rhamnogalacturonate lyase OS=Dickeya dadantii (strain 3937) OX=198628 GN=rhiE PE=1 SV=1
sp|B0YEH9|RGLA_ASPFC	4.08e-08	93	562	87	515	Probable rhamnogalacturonate lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=rglA PE=3 SV=1
sp|Q4W9T6|RGLA_ASPFU	4.08e-08	93	562	87	515	Probable rhamnogalacturonate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=rglA PE=3 SV=1
sp|A1D9P9|RGLA_NEOFI	3.48e-06	93	562	87	515	Probable rhamnogalacturonate lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rglA PE=3 SV=1
sp|Q5AX45|RGLA_EMENI	3.48e-06	52	569	52	521	Rhamnogalacturonate lyase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rglA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000249	0.999719	CS pos: 18-19. Pr: 0.9846

TMHMM  Annotations     

There is no transmembrane helices in QRD81270.1.