CAZyme Information: QRD81189.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: QRD81189.1
• CAZy Family: AA1
• CAZyme Description: glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573		64152.12	9.0517

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357_2020	13958	N/A	249	13709

Full Sequence      

MISEYVGEIEELPPDPRIWSGKRYRKYLYHTAQAAIWTSTVYYPIRLLMILLEAQQSWPM
WLMLAVEAIFGRLSYQDQRLTVAAGGEPERGPRKRLRLRGSHNLPRVDVLIPCCGEPVSV
ILDTVRAACTMDYPESQLRVLVLDDGASTQLRDAVSELHSKWPYLFYHTRGRQSGRVFAK
AGNLNYALFTIQKDTPPEFCAILDADSIPKPDFLRATLPHLLLSPQTALVTTRQYFDNLP
AGDPLSQSRLHFYTCQNAELDRCGRAIDAGSGAVFRRNAIIDVGGYPTFSFSEDWQLSLI
LRGMGYRTVQVQEPLQFGLVPTSLEGHIAQRNRWHIGHSQQLFTLRPPTSSSIPRHLQWS
IACGGLAITLGLVGHVIGYGAVPWLLMSRSLIPASSSFLIKTQVILGLLHVSTMWAYGWL
QTAHAGIRGSPFSQLENSWLAGAHLSAVIRFHFISSAPKGSFVTGSKENSWNRITKSSFY
KMLYQDLWQNGILQSICLLLATIAAMLLSTWTTLTTTDSELLTTRLLTTIAWPPLLHICY
LTVTNHWVPVAYLLSPPVYPARASQMAVLGSKE

Enzyme Prediction     

No EC number prediction in QRD81189.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	105	335	1.2e-21	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	8.69e-102	105	342	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	1.70e-39	36	483	2	431	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	2.52e-25	105	348	260	497	cellulose synthase catalytic subunit; Provisional
133059	CESA_CaSu_A2	2.18e-23	105	337	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
133045	CESA_like	7.82e-22	109	294	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD81189.1|GT2	QRD81189.1|GT2	0.0	1	573	1	573
UDD54668.1|GT2	UDD54668.1|GT2	0.0	1	572	1	572
QMW26873.1|GT2	QMW26873.1|GT2	0.0	1	445	1	445
QMW38953.1|GT2	QMW38953.1|GT2	0.0	1	445	1	445
BAE64416.1|GT2	BAE64416.1|GT2	0.0	1	445	1	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	5EJ1_A	2.79e-26	102	347	125	384	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	4HG6_A	3.14e-26	102	347	137	396	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	4P00_A	3.15e-26	102	347	138	397	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	7LBY_A	3.16e-23	105	348	273	510	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
6YV7_B	6YV7_B	6.07e-06	105	342	42	264	Mannosyltransferase PcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P58932|BCSA_XANAC	sp|P58932|BCSA_XANAC	6.14e-27	93	340	140	383	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1
sp|P58931|BCSA_PSEFS	sp|P58931|BCSA_PSEFS	1.48e-26	105	347	159	396	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
sp|Q9WX75|BCSA5_KOMXY	sp|Q9WX75|BCSA5_KOMXY	5.68e-25	105	340	146	376	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
sp|Q9RBJ2|BCSA4_KOMXY	sp|Q9RBJ2|BCSA4_KOMXY	5.68e-25	105	340	146	376	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
sp|P37653|BCSA_ECOLI	sp|P37653|BCSA_ECOLI	1.61e-22	105	348	273	510	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000010

TMHMM  Annotations     

Start	End
364	386
398	420
492	514
526	548