CAZyme Information: QRD07524.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD07524.1
• CAZy Family: GT8
• CAZyme Description: Carboxylic ester hydrolase [Source:UniProtKB/TrEMBL;Acc:Q0U575]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		32511.76	5.1174

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069044:920948-921922(+)

Full Sequence      

MKTSITALVTLLALAGLSFGRLEEVTDFGSNPTGLRMFVELPLSIINAQKDDNVSGKPIV
VHLHSCYSDAFQASTEINLPELGESLDFILIYPESTRNSNCWDVGSAASLTHNGGGDAGG
IISMINHTVTKYAADKTRIFILGNSEGGSMTNVLAGSYPDVFAAAASYRGAGFACYAGSA
GTDPKPMNTNQTCAEGIKHTPAQWGAFVRNAYPGYAGARPRMMIVNDVEDTLVRAQAGYE
TLTQWAEVLGVTNTANETGKAVEQGPEFTKMIYGTENKLVGYFGTLEAGKQVKVAVPAVL
KFFGLQ

Enzyme Prediction     

No EC number prediction in QRD07524.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	1.08e-29	52	259	7	208	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	3.69e-18	1	188	8	192	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	7.08e-18	56	180	15	140	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
395257	Peptidase_S9	3.49e-05	112	170	39	97	Prolyl oligopeptidase family.
224423	DAP2	7.63e-05	52	168	389	504	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD07524.1|CE1	5.64e-222	1	306	1	306
QRC90919.1|CE1	4.08e-110	1	305	1	294
QBH73477.1|CE1	4.02e-102	22	305	13	286
VBB78227.1|CE1	8.72e-86	7	305	5	290
QBZ57428.1|CE1	3.69e-82	6	305	4	290

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.15e-54	20	304	2	273	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HGR3|FAEB_NEUCR	1.38e-79	9	305	9	290	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2
sp|G2QND5|FAEB_MYCTT	2.45e-77	22	305	21	290	Feruloyl esterase B OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Fae1a PE=1 SV=1
sp|B8M9H9|FAEB_TALSN	2.11e-66	22	305	21	291	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q9HE18|FAEB_TALFU	6.91e-60	22	305	21	291	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|A2QZI3|AXE1_ASPNC	4.17e-55	20	304	30	301	Probable acetylxylan esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000204	0.999763	CS pos: 20-21. Pr: 0.9823

TMHMM  Annotations     

There is no transmembrane helices in QRD07524.1.