CAZyme Information: QRD06747.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD06747.1
• CAZy Family: GT31
• CAZyme Description: Carbohydrate esterase family 16 protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2IBC8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	CP069043|CGC2	39178.40	4.2992

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069043:368458-369698(-)

Full Sequence      

MPSSWSLRMLLASSAAGVGLAAQPSSCWRSGHFETLVTFGDSYTDENRLGYFINNNGSAP
PVGWDGGVGYATASGGLSWARYAAIYTSANLYNYAVSGAVCSNQVTPRLFAAIKAPFPDI
DSYELPAFIADSNYTTANGTKFFTGTPDNTVYTIWIGTNDLGNDAFLTDSQIKGKTVADY
MDCVYNQISRLYANGGRYFVIMNLAPLNLLPQYALPEDGGLPATQFFPTKQGMNATAING
RMHETVAALNQVYEYRTPYEVTFNQTWDDINVASFDVNSLMTDIYHNPAKYFNGTAPPNV
QGVVNLCDAQTSSNCTLADSPDSYEWYDPLHPSEQTSRVIAREFANVIAGNSTYATYWG

Enzyme Prediction     

No EC number prediction in QRD06747.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	36	344	9.8e-72	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	8.19e-60	35	347	1	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	3.70e-16	151	344	131	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	1.69e-14	33	348	1	281	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
225780	COG3240	1.46e-10	7	349	6	334	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
395531	Lipase_GDSL	5.63e-09	36	293	1	206	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD06747.1|CE16	3.25e-275	1	359	1	359
CAE7174737.1|CE16	8.16e-181	1	359	1	355
CBX90722.1|CE16	5.06e-164	1	350	1	349
USW54667.1|CE16	1.94e-126	6	358	11	366
QGA14322.1|CE16	3.20e-123	23	359	31	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JL1_A	2.46e-06	36	350	147	412	Crystal structure of VvPlpA G389D from Vibrio vulnificus [Vibrio vulnificus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	5.06e-80	33	358	27	345	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1
sp|B4FZ87|ACHE_MAIZE	9.34e-08	23	350	28	378	GDSL esterase/lipase ACHE OS=Zea mays OX=4577 GN=ACHE PE=1 SV=1
sp|Q99289|HLT_VIBPA	7.10e-06	36	343	147	405	Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=VPA0226 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.006502	0.993500	CS pos: 21-22. Pr: 0.9403

TMHMM  Annotations     

There is no transmembrane helices in QRD06747.1.