CAZyme Information: QRD06638.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD06638.1
• CAZy Family: GT31
• CAZyme Description: peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	CP069043|CGC9	43837.34	6.6010

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069043:146588-147896(-)

Full Sequence      

MRTLSYLNYALLACAPLVDAHPGMGEKMMFEMKRAANKEKRASSKELIGDLATLADSKLT
SIGKDIKAIITDQKSGESQERDTSIPAGAIGSAACKADLCCHWKWLSYEMTAKFNGTSGR
CNKFARQAVRLGFHDAGVWSKTAGYGGADGSLLLSNEMSRTDNNGLSQIAEQTKKWYTKY
NQYGLSMADIIQFGANVATVVCPLGPRIRTFVGRKDNSKAGPTSLLPTETDSADALLKLF
SAKTIDAHDLVALVGAHTTSQQHFVDTTRSGDPQDSSPGVWDMAFYPQTSNTSPPRVLKF
QSDVNLSKDSRTIGEWQEFSDRNSGQNHWNEDYAKAYTRLSMLGVNNINDLKECTKVLPP
ARTSFVNEDQVVLDMWLQGQFDQLNDMVDDAIQLTGVVSG

Enzyme Prediction     

No EC number prediction in QRD06638.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	111	345	2.8e-56	0.9607843137254902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173826	ligninase	2.19e-110	91	361	6	290	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
173823	plant_peroxidase_like	9.42e-32	121	341	14	254	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	3.92e-26	129	258	20	150	Peroxidase.
173825	ascorbate_peroxidase	1.25e-20	129	346	34	251	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
173827	secretory_peroxidase	3.96e-17	129	345	37	283	Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD06638.1|AA2	3.29e-298	1	400	1	400
CAE7175176.1|AA2	2.06e-237	1	399	1	398
CCF45286.1|AA2	4.15e-135	10	377	8	383
QDS77259.1|AA2	4.47e-126	1	384	1	384
UNI21317.1|AA2	3.94e-121	20	379	15	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q3U_A	8.93e-32	91	359	6	289	Trametes cervina lignin peroxidase [Trametopsis cervina]
4BM1_A	3.28e-31	98	362	13	293	CRYSTAL STRUCTURE OF MANGANESE PEROXIDASE 4 FROM PLEUROTUS OSTREATUS - CRYSTAL FORM I [Pleurotus ostreatus],4BM1_B CRYSTAL STRUCTURE OF MANGANESE PEROXIDASE 4 FROM PLEUROTUS OSTREATUS - CRYSTAL FORM I [Pleurotus ostreatus],4BM2_A Crystal Structure Of Manganese Peroxidase 4 From Pleurotus Ostreatus - Crystal Form Ii [Pleurotus ostreatus],4BM3_A Crystal Structure Of Manganese Peroxidase 4 From Pleurotus Ostreatus - Crystal Form Iii [Pleurotus ostreatus],4BM4_A Crystal Structure Of Manganese Peroxidase 4 From Pleurotus Ostreatus - Crystal Form Iv [Pleurotus ostreatus]
5ABO_A	1.02e-29	91	362	6	288	CRYSTAL STRUCTURE ANALYSIS OF FUNGAL VERSATILE PEROXIDASE FROM PLEUROTUS ERYNGII. MUTANT VPi-br. MUTATED RESIDUES T2K, D69S, T70D, S86E, A131K, D146T, Q202L, Q219K, H232E, Q239R, L288R, S301K, A308R, A309K AND A314R. [Pleurotus eryngii]
6A6Q_A	2.77e-29	79	362	5	300	Chain A, Ligninase H8 [Phanerochaete chrysosporium RP-78]
1LY8_A	3.32e-29	88	361	4	299	Chain A, Peroxidase [Coprinopsis cinerea],1LY8_B Chain B, Peroxidase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20013|LIGC_TRAVE	5.57e-29	119	359	59	319	Ligninase C OS=Trametes versicolor OX=5325 PE=1 SV=2
sp|Q9UR19|VPL1_PLEER	3.20e-28	79	359	28	313	Versatile peroxidase VPL1 OS=Pleurotus eryngii OX=5323 GN=vpl1 PE=1 SV=1
sp|P11543|LIG5_PHACH	3.75e-28	76	359	21	316	Ligninase LG5 OS=Phanerodontia chrysosporium OX=2822231 GN=GLG5 PE=2 SV=1
sp|P06181|LIG8_PHACH	3.81e-28	79	362	26	321	Ligninase H8 OS=Phanerodontia chrysosporium OX=2822231 GN=LPOA PE=1 SV=1
sp|P11542|LIG4_PHACH	5.24e-28	100	359	43	319	Ligninase H2 OS=Phanerodontia chrysosporium OX=2822231 GN=GLG4 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.017160	0.982814	CS pos: 20-21. Pr: 0.8744

TMHMM  Annotations     

There is no transmembrane helices in QRD06638.1.