CAZyme Information: QRD06561.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD06561.1
• CAZy Family: GT31
• CAZyme Description: Carboxylic ester hydrolase [Source:UniProtKB/TrEMBL;Acc:A0A7U2IB57]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302		32644.80	7.4735

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069042:1160412-1161425(-)

Full Sequence      

MHFSSLLTGLLTVAAVQGAAISADNQLIKRAALTEVQDFGSNPSGIKMFIYVPQKLQAKP
PVVLVLHACAWNANKFFATTKYGQLADQHGYVLIYGQTPTDGACWDVSSKQSLTHDGGSD
STGLANMVRYALKKYSGDASKVYVTGESSGAMMTQVMSAVYPDIFAAASEFSGEPAGCFF
TGTVRGWNSQCAGGQLHKTPAQWAEQVHAMYPGYSGQYPRMQVYHGDVDKTLNIASFNES
IKEWSGIFGYSGNPTQTQNNNPGAKLTKYIYGERLQGIWGHGIGHVVPTNETEALKWFGI
IS

Enzyme Prediction     

No EC number prediction in QRD06561.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	46	228	9e-20	0.73568281938326

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	5.72e-35	48	259	1	209	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
402228	Esterase_phd	1.05e-19	50	178	5	135	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
226040	LpqC	1.04e-17	10	288	13	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
226584	COG4099	1.18e-04	132	173	261	302	Predicted peptidase [General function prediction only].
223477	YpfH	0.004	47	173	4	132	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD06561.1|CE1	2.31e-228	1	302	1	302
QBZ64986.1|CBM1|CE1	6.46e-182	1	301	1	301
SMY28739.1|CE1	6.22e-176	1	300	170	469
SMR63396.1|CE1	6.22e-176	1	300	170	469
SMR60285.1|CE1	1.80e-175	1	300	201	500

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.43e-95	32	299	3	273	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WBW4|AXE1_ASPFU	1.80e-100	1	299	1	303	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1
sp|A1DBP9|AXE1_NEOFI	2.14e-98	19	299	17	303	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1
sp|B8NBI2|AXE1_ASPFN	2.43e-98	4	299	5	304	Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=axeA PE=3 SV=1
sp|Q75P26|AXE1_ASPOR	1.39e-97	4	299	5	304	Acetylxylan esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=axeA PE=1 SV=1
sp|A9JPE6|AXE1_ASPFL	1.39e-97	4	299	5	304	Probable acetylxylan esterase A OS=Aspergillus flavus OX=5059 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.009407	0.990539	CS pos: 18-19. Pr: 0.9441

TMHMM  Annotations     

There is no transmembrane helices in QRD06561.1.