CAZyme Information: QRD06397.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD06397.1
• CAZy Family: GT25
• CAZyme Description: Peroxidase [Source:UniProtKB/TrEMBL;Acc:A0A7U2IAR1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292		31158.03	4.8705

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069042:832770-833698(+)

Full Sequence      

MLSRFPILLALIAPTSAFSLWPRQTSSCPAVWTDVAKELQSTFSTCGRAAHGAIRAPFHD
CINNGCDGSLILTDECSRSENGGLSFICETLLDLTNKYKVSAADMIQFAAAYAISACPLG
PNVKALVGRTDSSVAAPLNSMPSSKDSVDSILAAFSARGFSSDDVVALLGTHSVAIQVVT
DPNNVGQPLDSTPAVCDTKYYVETQSGTAPSSLDSDLRMANDTQTAKTWTDFGNSQDLWA
AKFVDAWNRFAVIGNDVDSLQDCSSLIPTDSAKKRWAMSMPMGARGYARYHS

Enzyme Prediction     

No EC number prediction in QRD06397.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	32	255	1.4e-56	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173826	ligninase	2.45e-75	22	269	4	289	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
395089	peroxidase	4.11e-37	35	235	1	187	Peroxidase.
173823	plant_peroxidase_like	3.10e-28	34	250	2	253	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
173827	secretory_peroxidase	2.75e-24	26	246	9	274	Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites.
215545	PLN03030	2.96e-14	2	174	1	189	cationic peroxidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7013403.1|AA2	2.04e-100	12	277	11	275
CAE7196231.1|AA2	2.43e-61	28	274	73	322
QCC62988.1|AA2	2.66e-59	23	274	52	305
QRC96194.1|AA2	5.30e-58	27	274	76	326
QDS74803.1|AA2	8.96e-54	25	268	37	291

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VKA_A	1.36e-41	46	272	34	287	Site-Directed Mutagenesis of the Catalytic Tryptophan Environment in Pleurotus eryngii Versatile Peroxidase [Pleurotus eryngii]
3FM6_A	3.71e-41	46	272	34	287	Chain A, Versatile peroxidase VPL2 [Pleurotus eryngii]
3FMU_A	3.71e-41	46	272	34	287	Chain A, Versatile peroxidase VPL2 [Pleurotus eryngii]
3FM4_A	5.20e-41	46	272	34	287	Chain A, Versatile peroxidase VPL2 [Pleurotus eryngii]
2W23_A	7.24e-41	46	272	34	287	Structure of mutant W169Y of Pleurotus eryngii versatile peroxidase (VP) [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UR19|VPL1_PLEER	3.68e-40	46	272	64	317	Versatile peroxidase VPL1 OS=Pleurotus eryngii OX=5323 GN=vpl1 PE=1 SV=1
sp|O94753|VPL2_PLEER	1.41e-39	46	272	64	317	Versatile peroxidase VPL2 OS=Pleurotus eryngii OX=5323 GN=vpl2 PE=1 SV=1
sp|Q02567|PEM1_PHACH	3.15e-36	13	268	19	315	Manganese peroxidase 1 OS=Phanerodontia chrysosporium OX=2822231 GN=MNP1 PE=1 SV=1
sp|Q96TS6|PEM3_PHLRA	1.72e-35	46	272	58	318	Manganese peroxidase 3 OS=Phlebia radiata OX=5308 GN=mnp3 PE=2 SV=1
sp|P19136|PEM4_PHACH	2.56e-34	13	268	19	318	Manganese peroxidase H4 OS=Phanerodontia chrysosporium OX=2822231 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000259	0.999715	CS pos: 19-20. Pr: 0.7184

TMHMM  Annotations     

There is no transmembrane helices in QRD06397.1.