CAZyme Information: QRD06358.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD06358.1
• CAZy Family: GT22
• CAZyme Description: beta-xylanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354		39648.52	5.2619

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069042:763268-764332(-)

Full Sequence      

MKASLALTLLPLIAATPTPSKREPESAPGLGDLAKNAGLEYFGTAIDNVVLNNTQYTNIA
FNRSEFNQVTPSNGQKWMHIEPARNVFNYTLGDQVMVPAKSAGQIRRCHTFVWHSQLPDW
VRAGNFSKPELLSILENHIKQEAEYYSGDCYAWDTVNEAFEEDGSYRKDVWLDTIGPEYI
EHAFRWARQYTNPGTKLYYNDYGIERVNNKSLAVQKMVKDFIARGVPIDGVGLQAHFTVG
RAPTYDEVRNSQALFSSLGLDTALTELDVRIALPANATTEAIQAEVYANATRACVDEKKC
VGVTVWDFWDPVSWVPSAFPGNGDACLWRENFERKPAYYSIAEVLKNAAGKTRD

Enzyme Prediction     

EC	3.2.1.8:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	33	343	1.2e-92	0.9801980198019802

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	7.30e-129	30	343	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	3.51e-101	76	341	2	263	Glycosyl hydrolase family 10.
226217	XynA	9.16e-77	26	345	17	341	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD06358.1|GH10	1.31e-267	1	354	1	354
AGV40653.1|GH10	8.09e-172	1	349	1	353
QSZ37437.1|CBM1|GH10	7.87e-110	24	350	13	339
CAP68243.1|GH10	2.22e-109	3	351	7	361
VBB86180.1|GH10	2.22e-109	3	351	7	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WUF_A	4.50e-99	30	345	5	312	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	1.03e-97	30	345	5	312	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
6JDT_A	1.63e-95	29	338	2	310	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	1.45e-87	3	341	9	335	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3U7B_A	3.35e-86	26	345	1	324	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ZNB1|XYND_TALFU	2.58e-96	30	350	21	339	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|B4XVN1|XYNA_STRSQ	9.98e-96	1	349	16	354	Endo-1,4-beta-xylanase A OS=Streptomyces sp. OX=1931 GN=xynAS9 PE=1 SV=1
sp|Q2PGV8|XYN2_AURPU	8.27e-92	6	347	9	357	Endo-1,4-beta-xylanase 2 OS=Aureobasidium pullulans OX=5580 GN=xynII PE=1 SV=1
sp|O60206|XLNA_AGABI	1.95e-91	30	343	19	329	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|Q9HEZ1|XYNA_PHACH	3.92e-90	30	342	94	403	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999748	CS pos: 22-23. Pr: 0.9770

TMHMM  Annotations     

There is no transmembrane helices in QRD06358.1.