CAZyme Information: QRD06247.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD06247.1
• CAZy Family: GT20
• CAZyme Description: Peroxidase [Source:UniProtKB/TrEMBL;Acc:A0A7U2IAG1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525		55912.89	5.2342

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069042:372810-374481(+)

Full Sequence      

MLLSAKVIIASLLAGSKAAFYYPDVQTHLLEHILVDNWGTYASNFSSAITPCTNYVTQIG
TAALNSGRTTAAQWMRVLFHDFVTANVSAGTGGVDASIGFETARSENSGSAFNDSFTFWR
PFVNNAVSMADLVALGTAMSNNLCGGRNIPYRAGRIDATSAGSTTGVPAPETDLEETLVF
FERAGFDKVDSIGLTACGHTMGSVHHGGFPDVVEEIAVTPNNTNGGSNFDSTRGAFDPAV
LGEYLHGTGKRGGPLVTSNNVTTRSDLRLYESDQNATMQALFAQGDTFLDTCVGLFNRMM
NTVPTGVQLGPVIEALAVKPINVTFDFDAHGKLKLSGKFRILTGADDSPPLLLSFRVSNH
TSELLPETATGSSTFGRDGSRYGKLTYFPFSVSGPDLRRMTSFSVESSTVAVQSFAITGT
AFVVPRWTTLVDDYLNITLAISSPHTCEDVSLRIATAVPQHGTLAPVLKRTELALSQAKD
AVDKYTLCTTVATLDSDHIGLITLKVEMQGQILDTYLVNSGAAGW

Enzyme Prediction     

No EC number prediction in QRD06247.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	66	267	2.3e-24	0.7411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	2.88e-84	22	301	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
173823	plant_peroxidase_like	2.52e-18	71	301	18	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	2.74e-18	62	205	7	155	Peroxidase.
173826	ligninase	5.03e-11	71	252	38	215	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
173827	secretory_peroxidase	4.88e-09	56	205	18	173	Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI68923.1|AA0	4.03e-61	65	341	57	326
UKZ86986.1|AA0	1.73e-60	16	406	20	411
QKD59397.1|AA0	4.30e-58	30	341	29	326
QYT03617.1|AA2	8.98e-58	11	489	15	510
QRV79935.1|AA2	1.81e-56	9	507	9	511

PDB Hits     

QRD06247.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	4.02e-49	30	522	30	496	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q7XZP5|APX5_ARATH	2.54e-07	63	205	22	164	L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=APX5 PE=1 SV=2
sp|Q8GY91|APX6_ARATH	2.58e-06	71	203	114	248	Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana OX=3702 GN=APX6 PE=2 SV=1
sp|Q96512|PER9_ARATH	8.60e-06	71	202	76	215	Peroxidase 9 OS=Arabidopsis thaliana OX=3702 GN=PER9 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000248	0.999712	CS pos: 18-19. Pr: 0.9759

TMHMM  Annotations     

There is no transmembrane helices in QRD06247.1.