CAZyme Information: QRD06214.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD06214.1
• CAZy Family: GT2
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:Q0U0Q9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493		53599.54	5.5538

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069042:315493-316974(+)

Full Sequence      

MRLAITSNSASVGNVDIHETFRVIELDAGQYVETTKSTGLDGRSDSMSFSREALSAIETQ
LAIVVPCKDEAVSILDGVLHGIPHDCLIILVSNSKKDNFTAECNLLSDFCTDTRRSGIAC
HQHDPGFAEAFVAGGLPAIVRVVNGRPQIRNGKGEAMMMGAALAKLAGKKYIGFIDADNL
VSGAVHEYCKVYAAGLHYALHCTGDGGQPDTDAMTPHCMVRIKWNSKPKVKDGIIIFEKL
GRSSRVVNQWMNRLLTTVLGDEPEGNLQLIETGNAGEHAMSIDLAMDLKFATGYAVEPFQ
YIDAWERFSGRKFGDPESRLAQQSYDYEFLANDAAYTSSDESTLSSSASVSPISTPATSR
PPSLMPALPAHEVRILQVQTRNPHFHDTSKGADHISAMQAGGLSTIYHSALTPQDLKDDL
RQYFKDNLSDVKGVAEDGTPEAPRCYPSMSAMDFEVFHAKVKARNETMTVIGECGYNMLG
CYQCAVRCMTSSD

Enzyme Prediction     

No EC number prediction in QRD06214.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT55	7	461	3.7e-132	0.9869451697127938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
401440	Osmo_MPGsynth	0.0	5	461	1	380	Mannosyl-3-phosphoglycerate synthase (osmo_MPGsynth). This family consists of examples of mannosyl-3-phosphoglycerate synthase (MPGS), which together with mannosyl-3-phosphoglycerate phosphatase (MPGP) EC:2.4.1.217, comprises a two-step pathway for mannosylglycerate biosynthesis. Mannosylglycerate is a compatible solute that tends to be restricted to extreme thermophiles of archaea and bacteria. Note that in Rhodothermus marinus, this pathway is one of two; the other is condensation of GDP-mannose with D-glycerate by mannosylglycerate synthase.
237735	PRK14503	1.81e-111	1	468	1	388	mannosyl-3-phosphoglycerate synthase; Provisional
162866	osmo_MPGsynth	5.24e-96	2	457	1	376	mannosyl-3-phosphoglycerate synthase. This family consists of examples of mannosyl-3-phosphoglycerate synthase (MPGS), which together mannosyl-3-phosphoglycerate phosphatase (MPGP) comprises a two-step pathway for mannosylglycerate biosynthesis. Mannosylglycerate is a compatible solute that tends to be restricted to extreme thermophiles of archaea and bacteria. Note that in Rhodothermus marinus, this pathway is one of two; the other is condensation of GDP-mannose with D-glycerate by mannosylglycerate synthase.
184713	PRK14502	1.64e-84	1	459	1	383	bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional
395426	Glycos_transf_2	0.003	63	182	2	92	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD06214.1|GT55	0.0	1	493	1	493
CBX91462.1|GT55	2.96e-141	1	472	49	476
CAE7195471.1|GT55	2.67e-120	1	473	1	450
UQU66149.1|GT55	2.28e-101	1	458	1	383
AVT34790.1|GT55	1.89e-94	1	472	1	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WVK_A	7.35e-75	1	455	1	375	Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 apoprotein [Thermus thermophilus HB27],2WVK_B Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 apoprotein [Thermus thermophilus HB27],2WVL_A Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 in complex with GDP-alpha-D-Mannose and Mg(II) [Thermus thermophilus HB27],2WVL_B Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 in complex with GDP-alpha-D-Mannose and Mg(II) [Thermus thermophilus HB27]
2WVM_A	2.23e-73	1	455	1	375	H309A mutant of Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 in complex with GDP-alpha-D-Mannose and Mg(II) [Thermus thermophilus HB27],2WVM_B H309A mutant of Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 in complex with GDP-alpha-D-Mannose and Mg(II) [Thermus thermophilus HB27]
2ZU7_A	6.74e-58	13	468	13	389	Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU7_B Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU8_A Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU8_B Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU9_A Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU9_B Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UZC1|MPGS_PYRAB	1.25e-63	13	443	13	374	Mannosyl-3-phosphoglycerate synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=mngA PE=3 SV=1
sp|O58689|MPGS_PYRHO	7.20e-62	13	468	13	389	Mannosyl-3-phosphoglycerate synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=mngA PE=1 SV=1
sp|Q8U380|MPGS_PYRFU	1.07e-60	13	472	13	393	Mannosyl-3-phosphoglycerate synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=mngA PE=3 SV=1
sp|Q9YDM5|MPGS_AERPE	4.93e-36	1	446	1	362	Mannosyl-3-phosphoglycerate synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) OX=272557 GN=mngA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999952	0.000106

TMHMM  Annotations     

There is no transmembrane helices in QRD06214.1.