CAZyme Information: QRD05574.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD05574.1
• CAZy Family: GT8
• CAZyme Description: Chitin-binding type-1 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2I979]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	CP069041|CGC9	32955.42	4.8128

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069041:151180-152224(-)

Full Sequence      

MKWIAVGLASSLGISVTVASSLSLEAPISHDPFADTILQDAAPQSVTTRNATSPRLLLRL
LHQLDARQEAGRCGPSAGGASCTGSQCCSTFDYCGTDPEHCGIIVGCQPQYGRCGDAPPD
TPSPTPTPTPTPSPSSSSTVVSASSSTVVPSSSSILPSSSSVLPPLPSGTLIVSPNGQCG
NITTCAGSGFGSCCSEWYFCGSGLQYCGTGCRSSFGTCSGVAPPPSSSVPAPISSSSSSS
TSSAIGTTTTPTPTPTPTSTATPTPTTTSSAPPVPTNVSTNGRCGAEGSGMTCSGSTYGR
CCSDYGWCGTGDDFCLPSWGCRPQFGSCGST

Enzyme Prediction     

No EC number prediction in QRD05574.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395135	Chitin_bind_1	2.43e-05	72	108	1	35	Chitin recognition protein.
211316	ChtBD1_1	5.40e-05	184	218	9	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	2.23e-04	289	329	6	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	3.13e-04	283	315	1	30	Chitin recognition protein.
211311	ChtBD1	6.96e-04	72	110	1	37	Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD05574.1|CBM18	5.77e-184	1	331	1	331
CBX99129.1|CBM18	3.63e-62	103	329	95	309
CAE7027266.1|CBM18	7.18e-61	30	330	37	317
QBZ64147.1|CBM18	1.70e-54	63	329	45	277
BAI44117.1|CBM18	6.94e-47	63	329	45	266

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MPI_A	7.84e-07	72	110	4	40	Crystal structure of the chitin-binding module (CBM18) of a chitinase-like protein from Hevea brasiliensis [Hevea brasiliensis subsp. brasiliensis],4MPI_B Crystal structure of the chitin-binding module (CBM18) of a chitinase-like protein from Hevea brasiliensis [Hevea brasiliensis subsp. brasiliensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P86473|CHIT_ACTCC	1.41e-08	56	123	7	69	Endochitinase OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc04863 PE=1 SV=2
sp|P09761|WIN1_SOLTU	1.81e-07	51	123	6	77	Wound-induced protein WIN1 OS=Solanum tuberosum OX=4113 GN=WIN1 PE=2 SV=1
sp|P93680|CHIT_PERAE	2.02e-06	51	112	6	65	Endochitinase OS=Persea americana OX=3435 GN=chi1 PE=1 SV=2
sp|P0DKH7|AMP1_FAGES	3.63e-06	72	108	2	36	Antimicrobial peptide 1 OS=Fagopyrum esculentum OX=3617 PE=1 SV=1
sp|P0DKH8|AMP2_FAGES	3.63e-06	72	108	2	36	Antimicrobial peptide 2 OS=Fagopyrum esculentum OX=3617 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000517	0.999473	CS pos: 21-22. Pr: 0.8166

TMHMM  Annotations     

There is no transmembrane helices in QRD05574.1.