CAZyme Information: QRD05297.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD05297.1
• CAZy Family: GH85
• CAZyme Description: alpha/beta-glucosidase agdC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
997		112545.47	6.5377

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069040:741588-744722(+)

Full Sequence      

MSSMTYSAAPRWTALFLLWAVLCSVFAPAAAVKHENFKTCDQSGFCKRNRQFADDVSASS
SWTSPYALEPASIKFNKGQLEAVVLKTVQEGGEKVSLPLTITFLESGLARVTLNEEKRAK
GQVELRHESKARKERYNEAGQWAIVGGLNPALGAALSETADAGFTKVVYGNGGNHQAIIR
HAPFSIEFQRDGETQVKFNERGFMNMEHWRPKVEKPVVEKKEGEEGTKDEEPAPEAQGPD
ESTWWEETFGGNTDSKPRGPEAVALDISFPGYEHVFGIPEHATGLSLKTTKGGDNAYTEP
YRLYNADVFEYELDSPMTLYGAIPFMQAHRKGSTVGVFWLNAAETWIDIVKTKNTANPLS
LGTKGHTDTQTHWMSESGIMDVFVFLGPTPQDMTRQYGELTGYTAMPQSFAIAYHQCRWN
YVTDEDVKDVDRRFDKFNIPYDVIWLDIEYTQEKKYFTWDPLTFVNPDTMQKQLDKRERK
LVAIIDPHIKNTDSYPVIDELKKKDLAVKNKDGDQYEGWCWPGSSMWVDCFNPAAIDWWK
GLFKYDKFKGTAHNTFIWNDMNEPSVFNGPETTMPKDNLHHGNWEHRDVHNINGMTFHNA
TYQAIVERKKGEVRRPFVLTRAFYSGSQRSAAMWTGDNLAEWAHLEASLPMVLNQGISGF
PFAGADVGGFFGNPSKELLTRWYQAGIYYPFFRGHAHIDTRRREPYVAGSPYTEIITQAL
RLRYQLLPAWYTAFHEAATNGAPIVRPNFYVHPEDERGFAVDDQLYIGSTGLLAKPVTKE
GADSVSVYIADDQPYYDYFDYTTYSGAGHHTVPAPLEKIPLLMQGGHIIPRRDRPRRSSG
LMKYDPFTLVVVLDKDGNASGTLYIDDGETFDYQSGAFIHRTFNFDGGRQILTSGNLDTS
APSSKAQKYIKSMDKVKIEKIIIVGAPKAWKGKESVVVMEEGSKETKRRRPTAVEWHAAE
GKKAAWAVVRKPDVGVGRGWRIDFGEKEGHEHHGHEH

Enzyme Prediction     

EC	3.2.1.20:27	3.2.1.84:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	383	829	2.3e-148	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395838	Glyco_hydro_31	0.0	383	827	1	440	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269889	GH31_GANC_GANAB_alpha	0.0	402	870	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
224418	YicI	2.03e-169	258	887	138	726	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269890	GH31_glucosidase_II_MalA	6.75e-141	402	741	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
215408	PLN02763	3.04e-109	388	879	164	644	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD05297.1|GH31	0.0	1	997	1	997
KAF1918743.1|GH31	0.0	1	997	1	998
KAF2826977.1|GH31	0.0	1	997	1	997
KAF2024293.1|GH31	0.0	32	997	2	967
KAF1848001.1|GH31	0.0	1	997	1	998

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DKX_A	0.0	32	985	5	951	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DKY_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5JQP_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5DKZ_A	0.0	32	985	5	951	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DL0_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
7KRY_A	2.54e-254	10	982	10	940	Chain A, Neutral alpha-glucosidase AB [Mus musculus],7KRY_C Chain C, Neutral alpha-glucosidase AB [Mus musculus]
5IEF_A	3.67e-254	32	982	1	909	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	3.79e-254	32	982	1	909	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9US55|GLU2A_SCHPO	4.85e-303	20	925	14	885	Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gls2 PE=1 SV=1
sp|Q8BHN3|GANAB_MOUSE	1.62e-254	12	982	15	941	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1
sp|Q4R4N7|GANAB_MACFA	8.23e-252	12	982	15	941	Neutral alpha-glucosidase AB OS=Macaca fascicularis OX=9541 GN=GANAB PE=2 SV=1
sp|Q14697|GANAB_HUMAN	1.64e-251	12	982	15	941	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3
sp|Q9FN05|PSL5_ARATH	8.81e-251	15	982	5	918	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999768	CS pos: 31-32. Pr: 0.9726

TMHMM  Annotations     

Start	End
13	32