CAZyme Information: QRD03743.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD03743.1
• CAZy Family: GH5
• CAZyme Description: peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
531	CP069037|CGC1	57617.12	4.8763

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069037:1231296-1232939(+)

Full Sequence      

MRSSQIISLALLAPISQAYVWPSKYDDLDDLLYMQFGYVRNGQLSDQVQSCDFGAKQPGV
QKAAQWVRTAFHDAATYDATTKIGGLDASIQYELDRPENLGAALNSTLADISSLVTTRSS
AADLLALSLVMSVARCANMRVPLRLGRKDATEAGIKGVPEAHTDLDTSRKRFATMGMDEA
DMITLIACGHSIGGVNSVDHPEIVSGPVSPENKASFDTTKGAMDNQVVLEYLDNSTANPL
IVNANDTLNSDKRIFAADGNATMRKLADKAYFKSKCENAFERMLNLVPGDVTLSEPIEPA
DIRPFITQYALNANGSIEFSGRIRVRTTPVTGRDTNNLTASIILPSRSGSSPTEVVAKQA
TYKLGQTYGYLDEVFLWFEFKTVIPASAAISSFNIRVNDDVYDNAGTGGYPVNPDVLYQA
PQSCTFADPTTKQWSITMVAAVSKSLLQGGAEPQLNVVKKPRKPRSFLPELTPEIVKMEH
AGKETAEYVYFTATTPLSTDGLDPRVDIEVGDSKVEYILTTALTQQKCAAL

Enzyme Prediction     

No EC number prediction in QRD03743.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	44	244	1.9e-28	0.7568627450980392

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	3.71e-113	21	285	1	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
173823	plant_peroxidase_like	2.43e-25	60	285	15	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	3.90e-23	48	193	1	152	Peroxidase.
173826	ligninase	2.16e-13	44	239	20	214	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
173825	ascorbate_peroxidase	4.65e-12	67	286	34	248	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59397.1|AA0	1.41e-102	1	526	1	528
QGI68923.1|AA0	4.38e-101	1	529	1	530
QBZ57066.1|AA0	9.82e-86	2	494	7	497
QRV94524.1|AA2	5.78e-84	6	510	4	510
QRV79935.1|AA2	3.16e-83	6	510	4	510

PDB Hits     

QRD03743.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	1.44e-69	21	433	23	455	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q7XZP5|APX5_ARATH	2.27e-10	67	193	34	161	L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=APX5 PE=1 SV=2
sp|Q8GY91|APX6_ARATH	2.00e-07	62	193	113	247	Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana OX=3702 GN=APX6 PE=2 SV=1
sp|Q6ZJJ1|APX4_ORYSJ	5.04e-07	67	202	35	168	Probable L-ascorbate peroxidase 4, peroxisomal OS=Oryza sativa subsp. japonica OX=39947 GN=APX4 PE=2 SV=1
sp|Q0JEQ2|APX3_ORYSJ	2.86e-06	67	193	36	164	Probable L-ascorbate peroxidase 3, peroxisomal OS=Oryza sativa subsp. japonica OX=39947 GN=APX3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000290	0.999697	CS pos: 18-19. Pr: 0.9787

TMHMM  Annotations     

There is no transmembrane helices in QRD03743.1.