CAZyme Information: QRD03619.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD03619.1
• CAZy Family: GH5
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2I6K9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642		68790.03	6.3227

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069037:916552-918528(+)

Full Sequence      

MRVLQILGQLAAFTSLASAVDLEGYEYVVVGSGAGGGPLAARLAIAGHKTLLIEAGDDQG
TNVNYTVPSYNARVSEDPNLSWNFFVKHYADEKRQARDYKTTYETPDGGRYTGLTPPAGS
KQLGTLYPRTGTLGGCTAHNALIAVYPHQSDFDFISSLTGDQSWSAANMRKYFSKLEDNH
YLLPGQKGHGYDGWLGTQYSPIDIVLTDPKLLSLVTGATFALGNETNAVINLASLLAGDA
NADTKTRDTQPAVYQIPLSTADGKRTGSREFVLAVRDAVNANGTKRFPLDVRLNCHVTKV
TFDQSVTPPRANGVEFLDGQYLYKASPKSRGAAGIPGSVKASREVIVAGGTYNSPQLLKL
SGVGPADELKRFDIPVVADLPGVGTNLQDHYEINVQGKAPSNFSALDGCTFGEGGEASDP
CLARWQKSVLGNRGIYASPGLGAAMFYKSSVAARNEFDVFVFGGPVNFRGYFPGYSFNAT
HEHDWFTWAILKAHPRNNAGSVTLQSANPLDVPAITYNYFDTGSGDYQSDITALSEAVKL
ARSSFKRQLVKIDEVLPGKDANVDDYIKDTAWGHHASSTCPIGADNDPMAVLDSSFRVRG
TAGLRVVDASVFPRIPGTFTAVSTYMVAEKAADVILAELAAQ

Enzyme Prediction     

No EC number prediction in QRD03619.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	24	637	1.9e-95	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.56e-65	39	636	20	532	choline dehydrogenase; Validated
225186	BetA	1.52e-56	39	642	22	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	8.03e-31	500	631	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	7.78e-19	289	618	235	559	Protein HOTHEAD
366272	GMC_oxred_N	1.59e-15	125	392	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7216261.1|AA3	0.0	11	641	10	646
QMW33146.1|AA3	0.0	1	639	1	645
QRD84722.1|AA3	0.0	1	639	1	645
QMW45179.1|AA3	0.0	1	639	1	645
UDD58256.1|AA3	0.0	1	639	1	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NCC_A	9.11e-42	17	632	16	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YRU_AAA	1.02e-41	18	632	1	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	1.02e-41	18	632	1	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	1.02e-41	18	632	1	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	1.89e-41	25	632	8	557	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6X2G7|BETA_BRUA4	1.38e-47	26	636	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1
sp|A9M9H8|BETA_BRUC2	9.27e-47	26	636	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) OX=483179 GN=betA PE=3 SV=1
sp|Q8G1Z8|BETA_BRUSU	3.28e-46	26	636	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=betA PE=3 SV=1
sp|B0CKN4|BETA_BRUSI	3.28e-46	26	636	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) OX=470137 GN=betA PE=3 SV=1
sp|A5VPA6|BETA_BRUO2	3.28e-46	26	636	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) OX=444178 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000509	0.999491	CS pos: 19-20. Pr: 0.9616

TMHMM  Annotations     

There is no transmembrane helices in QRD03619.1.