CAZyme Information: QRD03274.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD03274.1
• CAZy Family: GH47
• CAZyme Description: Nucleotide-diphospho-sugar transferase [Source:UniProtKB/TrEMBL;Acc:Q0UDW5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431		48916.24	5.5842

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069037:258565-259860(+)

Full Sequence      

MLAVFAQKRVVAVAAAFFAICLLLASSGHYYYRGSSLNATPEPAFEHKHDVVVKPPHYTE
PIPKQKPADENLLEHTPEGVDKGDPRPDVPASPDVPASPDVPASPDAAAGHVVSEHHGNP
KNTGLKPDGTERLAYVTFLSGTLDQDEDLEADNYFVAVRILMWQLLHNPETRTKDIDVVV
MVTPSVSQSRRDRLKKDGAIVYPVEFLRSSSRWAKAGDARWDDVMTKLRVWEMTQYSRIL
VMDGDSMLLKPLDGVFDDPGAQIRSTKQVDDYKPIEGVKPLPPTYLLGSLSEVWDSTHDF
PPTHGTGLKKPGYMNAGFFMLAPSIAAFELYSSYLEIPDSFDPRYPEQNLLNQIHKWDGP
MPWTELAYTWNIRCPSDNDIDKGLVSLHEKWWTQPFLYENQRTKDWLKSRRWEMKGFFDA
YDRFHRDGETR

Enzyme Prediction     

No EC number prediction in QRD03274.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	152	382	7.3e-27	0.7821011673151751

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	9.06e-34	134	375	2	185	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	1.29e-22	123	419	48	364	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
133064	GT8_GNT1	3.88e-08	176	256	30	112	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
215090	PLN00176	4.10e-07	134	382	24	252	galactinol synthase
132996	Glyco_transf_8	2.24e-04	152	263	10	123	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD03274.1|GT8	1.42e-301	1	431	1	431
CAE7030192.1|GT8	3.65e-144	131	422	139	423
CBY01000.1|GT8	1.93e-118	121	427	97	403
SMR42298.1|GT8	5.92e-66	134	420	67	349
SMY19627.1|GT8	5.92e-66	134	420	67	349

PDB Hits     

QRD03274.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43061|MU136_SCHPO	5.72e-22	123	419	49	364	Meiotically up-regulated gene 136 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug136 PE=1 SV=1
sp|O43062|YGT9_SCHPO	8.15e-22	128	409	67	363	Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4C3.09 PE=4 SV=1
sp|Q09680|YA0C_SCHPO	1.64e-20	150	392	81	340	Uncharacterized protein C5H10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC5H10.12c PE=4 SV=1
sp|Q9FXB2|GOLS2_ARATH	2.84e-14	129	422	18	292	Galactinol synthase 2 OS=Arabidopsis thaliana OX=3702 GN=GOLS2 PE=1 SV=1
sp|O80518|GOLS3_ARATH	7.25e-13	129	422	12	286	Galactinol synthase 3 OS=Arabidopsis thaliana OX=3702 GN=GOLS3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999843	0.000167

TMHMM  Annotations     

Start	End
9	31