CAZyme Information: QRD02987.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD02987.1
• CAZy Family: GH43|CBM91
• CAZyme Description: Extracellular serine-rich protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2FCX1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693	CP069036|CGC2	75963.27	5.4415

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069036:1014405-1016716(-)

Full Sequence      

MASSCHSLLRFCALSFILLFLQGASAYIGSATISGTVLIIARDTTSAENGAAAGLRGYGI
PFEILTVPQAGISNLPVLNSSATHGNYGGIVTISEVGYNYDTSYYSALTRRQWNDLYAYQ
SAFGVRMVRLDVFPTTDFGVSSLGGNVNDEPVTFTNTSAFSIAGLKTNVGISIANIYHTP
ATIVNASIAWEIAQFGTAGTAAVINQIGDRQQMAWFMPFALDWAPSSNIVQHSWITWVTR
GLFVGFRRIYLGTQVDDMFLETPMYRPQGQNYRCKPEDLDLHVTWQADLNSRLPKGSEYF
LEIGHNGNGDIEAAANTAAGEQVCSPGNGMASGAIEYAEQPDGSPEYTKPPGTGKDIWPS
APAKYSWSQECAQLDELQNWFADQDNLDNFAHISHTFSHADLTNATYTDASKEIAFNRAW
LKQNGIDGAKRWSDSGIIPPAITGLHNADAIKGWMDNGIFNVVGDNTRPLLRNSNTFWPL
NTTVAGNGYAGLNIMPRWATLIYYNCDLPACTLQEWIDTSAGKGTFTDLLDNVRDTAIRN
LFGLHWDAYMFHQANMRVNDVPTTTVNGKRDRFSLLMTWVETVTAEMMRLTTWPMKTLKH
DDLAQTFLNRQARDLCRPSLTWTTSANGASIESINIYTAGGNTCKTPIPITVPVATASST
GATKEQVGSDPLTLWVTMSGASRNYKFTTPYRL

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE18	249	620	2.6e-189	0.9945504087193461
CBM87	40	248	3e-90	0.9954128440366973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
213023	CE4_NodB_like_5s_6s	3.18e-04	352	425	38	102	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD02987.1|CBM87|CE18	0.0	1	693	1	693
CBX97839.1|CBM87|CE18	0.0	1	688	1	694
CAE7218893.1|CBM87|CE18	0.0	7	693	5	687
QDS72757.1|CBM87|CE18	1.59e-249	29	690	39	705
QLI69755.1|CBM87|CE18	8.33e-238	32	693	25	691

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NWZ_A	1.88e-235	32	693	22	684	Crystal structure of Agd3 a novel carbohydrate deacetylase [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

QRD02987.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000220	0.999772	CS pos: 26-27. Pr: 0.9801

TMHMM  Annotations     

Start	End
7	29