CAZyme Information: QRD02870.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD02870.1
• CAZy Family: GH43
• CAZyme Description: Glycoside hydrolase family 1 protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2I5U0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480		55049.66	5.3960

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069036:705059-706911(-)

Full Sequence      

MSQSYLPKDFLWGFATASYQIEGAPHEDGRADSIWDSFCRIPGKIAGGESGEVACDSYHR
TAEDIDLLKKLGAKSYRFSLSWSRIIPLGGRNDPVNEKGLQHYVKFVDDLREAGIEPMIT
LFHWDLPDNLHKRYMGMLNKDEFVKDFEYYSRVCFKAFGSKVKYWITFNEPWCSSILGYG
TGLFAPGRCSDRSKSAEGDSSREPWAVGHALLIAHGAAVKAYREDFKAKDGGQIGITLNG
DWTEPWDAEDPQDREACDRKLEFAICWFGDPVYFGKYPDSMRKQLGDRLPEFTAEESALV
KGSNDFYGMNHYCAHYVRHKETEPELDDHLGNLETLHQNKQGEWIGPETESFWLRPMPLG
FRKLIKWLSDRYGGPTFYVTENGTSLKGENELPLEQLLDDEFRCEYFRGYVGALADAHTH
DGVDVRGYSAWSLMDNFEWAEGYTTRFGVTYVDYKGGQKRYPKKSAYEISKIFEKYIKKE

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	4	475	1.2e-159	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	0.0	6	467	5	442	Glycosyl hydrolase family 1.
274539	BGL	1.20e-164	7	467	1	424	beta-galactosidase.
225343	BglB	4.74e-137	6	474	4	451	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	1.75e-114	6	466	28	473	beta-glucosidase
215455	PLN02849	8.33e-114	2	467	26	474	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD02870.1|GH1	0.0	1	480	1	480
CAE7220638.1|GH1	0.0	1	480	1	480
CBX97760.1|GH1	0.0	20	480	124	584
QRD82378.1|GH1	2.21e-280	2	479	5	482
QMW27934.1|GH1	2.21e-280	2	479	5	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	3.98e-267	1	480	21	499	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	2.87e-240	6	480	3	466	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	3.16e-237	6	480	3	466	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	6.30e-237	6	480	22	485	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	2.58e-233	6	477	9	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	2.11e-197	6	477	11	475	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	2.74e-181	1	477	1	460	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q5Z9Z0|BGL24_ORYSJ	2.60e-146	3	466	30	495	Beta-glucosidase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU24 PE=2 SV=1
sp|B8AVF0|BGL12_ORYSI	5.11e-145	1	475	34	510	Beta-glucosidase 12 OS=Oryza sativa subsp. indica OX=39946 GN=BGLU12 PE=3 SV=1
sp|Q7XKV4|BGL12_ORYSJ	5.11e-145	1	475	34	510	Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000002

TMHMM  Annotations     

There is no transmembrane helices in QRD02870.1.