CAZyme Information: QRD02069.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD02069.1
• CAZy Family: PL42
• CAZyme Description: Chitin-binding type-1 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2FB61]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
528		52791.15	4.8615

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069035:571449-573144(-)

Full Sequence      

MLSLALLVLSSLLSLTEAQSKPISKNARCGSAYRGQTCQGSTFGNCCSTYGYCGSTSDYC
APQKCQKDFGSCNGAQVSSVRGTTLSSVIVPANPSLASAVRETVTVTSTLTPPGQRIVTV
TLTPSAVPAVTVTSTQSGAAAITVTSTQSAAPAITITLTPSAAQIVTVVGTPSLLPASTI
TVLETLAPLAASTITVVTTAAPLPASTVLQTVVETLPPLAASTITVVTTAAPLAPLTVTS
TETAPPLAASTVTLIETAPPLAPLTVTSIETAPPLAASTITVIETPAPLAASTVTVVETP
SPSTLTVIQSATPLAASTITLTETPSPLAASTVTVVESATPLAASTITETATISATPLPG
VITTSTVTASAAATCPTGNVVVNGDFEQSLTGNWITLPAGDSTLERTAGSSAPGGTYGFR
SRIGSTNSNFPQRLVQAVTLCPGVKYQASFSARRATSAGQVSVLLYLGDSQLAGGVITST
TFALLSSATFIAPASMSAALLRFEFGYQGAVGSTKEIQIDSVVLTKVS

Enzyme Prediction     

No EC number prediction in QRD02069.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
211316	ChtBD1_1	2.97e-18	28	73	1	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	1.03e-11	28	66	1	35	Chitin recognition protein.
211311	ChtBD1	1.71e-11	28	66	1	35	Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
214593	ChtBD1	5.60e-08	28	66	1	35	Chitin binding domain.
236766	rne	9.66e-08	210	377	853	1010	ribonuclease E; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD02069.1|CBM18	4.07e-156	1	528	1	528
QRC91344.1|CBM18	3.39e-17	374	526	267	426
QRC98722.1|CBM18	7.57e-12	17	74	18	75
QRC93519.1|CBM18	1.20e-10	16	89	83	156
QRC94890.1|CBM18	2.25e-08	18	89	97	174

PDB Hits     

QRD02069.1 has no PDB hit.

Swiss-Prot Hits     

QRD02069.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999732	CS pos: 18-19. Pr: 0.9806

TMHMM  Annotations     

There is no transmembrane helices in QRD02069.1.