CAZyme Information: QRD01891.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD01891.1
• CAZy Family: GT66
• CAZyme Description: Carbohydrate-binding module family 18 protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2FAV1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		40806.49	7.9825

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069035:242030-243339(+)

Full Sequence      

MRSAVFALTFASVSLAVAQRVSTTARCGPSFGGLTCRGSTFGNCCSQYSYCGSTTAYCGT
GCKSGYGDCKSSVSSIVKPSSTFVLVASSSTRTSPSSSPTSTLKVTTNARCGVDGSNRTC
KGSQWGNCCSRYNYCGSTVDYCGKGCQEGFGDCNSSPAQSSISSSSSKSVTSSKTSSMST
TSKLWSSSSSSSASSTPTISSISLPTPSSSLTMVSLTTSSVSSSSSSSSSSSVSSSSLLS
STVATTTIASSDSTATASSAPTSSSTSESSSTPTSSSTSSSTPTPSASPTCEQVEVYTAA
NGAQFNLNIGCTRYIYTISNPNQNGGPINTIDTTTQTSIEACAEFCSLAANCLYIDFYET
TCSRITAISTYNGDGLSPNKQTFIKTGYRVTSSSPVPALAET

Enzyme Prediction     

No EC number prediction in QRD01891.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
211316	ChtBD1_1	1.16e-10	110	154	1	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	3.38e-10	26	70	1	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	2.30e-08	26	64	1	36	Chitin recognition protein.
395135	Chitin_bind_1	1.23e-07	110	147	1	35	Chitin recognition protein.
211311	ChtBD1	5.29e-07	110	147	1	35	Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD01891.1|CBM18	8.35e-143	1	402	1	402
QRC98950.1|CBM18	9.75e-12	9	160	11	140
QRC93519.1|CBM18	1.43e-10	17	163	17	149
QRC98400.1|CBM18	2.26e-10	17	163	17	160
QRD03434.1|CBM18	4.31e-09	1	161	1	142

PDB Hits     

QRD01891.1 has no PDB hit.

Swiss-Prot Hits     

QRD01891.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000326	0.999647	CS pos: 18-19. Pr: 0.9754

TMHMM  Annotations     

There is no transmembrane helices in QRD01891.1.