CAZyme Information: QRD01710.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD01710.1
• CAZy Family: GH3
• CAZyme Description: Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:A0A7U2FAJ6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
876		94864.43	8.4627

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069034:1228834-1231616(-)

Full Sequence      

MKMLSSAYGIALTALLLATNLPLAAAGATPTNRTTVGGRERIGINYGWRFQRFTSNPDSL
SYNTLKSWILPSGNDFIKSSGSKKTRPTGPQPGANLNFTQASFNDAKWEAVDIPHDWAIR
GPFNAPGVSGAMGRLPSNGVGWYRRVVSFSAEDAGKTIFLDVDGAMSYAAVWLNGNLVGG
WPYGYASFRLDLTPYVKTGADNTLAIRLDNALDNSRWYPGAGIYRNIWLVKLNPVHVAQY
GTFVTTPTVSSSSATVSLVVDIENKGNSSQIVDVVTEIRPQDQSGVQGSVVATLSKASGT
VAAGGKAVVSASATVASPKLWGPKPDQTPNLYVATTRLSVNGQVIDAYETPFGIRTIIYD
KDTGISVNGQKIRIQGTCNHHDLGSLGTAFNYRAQERQFQILQEMGNNALRTSHNPPAPE
FLELADKMGLVVLDEIFDCWKQSKTKNDFSLIFDDWHEPDLRLFIRRDRNHPSVIAWSFG
NEIPEQQGAAGGTIGAELRGIIRDEDSTRQTTAGMNSASPDQALSAQVDIVGLNYNGEGI
GVSTSSAWPGFRSKFPNKMMWGSETSSCLSSRGTFVFPVTSGMAAVVSGNSGGGEDTVGM
RVSAYDLYSDWWASGSPDKVFFMQDKYPYVAGEFVWTGWDYLGEPTPFNDKARSSYFGII
DMAGFKKDRFYLYQARWAPNVRMAHILPHWTWPDRIGQITPVHVYSSADEAELFVNGKSA
GRLKRGISSWRFRWDNVVYQPGDLKVITYKNGQEWATDTKKTVGNAAKLVLSADRSDIRG
DGLDLSFITARVVDTNGDTVPRASNSISFSITGPGLISTTDNGDPADFAVFSSLTRKAFS
GLALAIIRSNAGAVGNLTISAVSSGLTGSSVTVQAR

Enzyme Prediction     

EC	3.2.1.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	40	659	5.1e-111	0.586436170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	4.08e-53	106	680	40	539	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	6.46e-48	81	534	29	470	beta-D-glucuronidase; Provisional
408349	Glyco_hydro2_C5	5.31e-36	769	872	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
236673	ebgA	4.01e-33	97	509	62	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
406696	DUF4982	3.94e-25	697	758	1	62	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD01710.1|GH2	0.0	1	876	1	876
AEO59435.1|GH2	0.0	38	875	43	880
CAE7211356.1|GH2	0.0	2	874	29	903
AEO71826.1|GH2	0.0	25	873	17	861
QRD03755.1|GH2	0.0	39	875	42	880

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	1.58e-194	102	874	48	819	Crystal structure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	3.74e-174	102	873	27	799	Chain A, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	2.30e-167	38	873	6	805	Chain A, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
6QUB_B	8.02e-144	102	873	30	851	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum]
6QUB_A	1.68e-143	102	873	53	874	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum],6QUC_A Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUC_B Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUD_A 2-deoxy-galactose reaction intermediate of a Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7LXS9|BGH2A_BACO1	1.02e-183	93	866	56	839	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
sp|T2KM09|PLH16_FORAG	3.15e-115	97	827	64	772	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|T2KN75|PLH17_FORAG	1.38e-56	55	816	22	739	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
sp|T2KPJ7|PLH8_FORAG	8.55e-47	95	727	66	679	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	2.97e-43	140	817	57	693	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999740	CS pos: 26-27. Pr: 0.9743

TMHMM  Annotations     

Start	End
7	29