CAZyme Information: QRD00986.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD00986.1
• CAZy Family: PL4
• CAZyme Description: Carbohydrate-binding module family 18 [Source:UniProtKB/TrEMBL;Acc:A0A7U2FDK4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
563		57269.71	7.2500

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069033:1135012-1136868(+)

Full Sequence      

MLTLLRAFAVCTVIVQIALGAPASQAISKNARCGASFGSLTCKGGSFGNCCSQYGHCGSS
SAYCGQGCQSGYGTCSSSPSVPPPTQIVSTDGRCGTARGISCSGSKFGDCCSDHGWCGRS
AAYRGKGCNPLYGNCTDGQPSSTRAIPSQSSVRSVPLPSSSQFVVSTNARCGSAYEAFPK
GMTCRGSKFGNCCSQYSYCGSGESYCGKGCQPGFGNCDARLSAPVSSSTYLASTSKTSMI
EVTSTSSATSTFALPSSSFTPDVFSSSSTPVVSSSSSISALSLIAVDTPSLASSVAISSG
SSDVQSTTTQTSSSTLSQTPVLSSLVGSPMPTPTTTLGDSPSSSVVPTVDSSTTVSSSEV
ATSTPTSSSEASISTPISLIDNPSTTVASTSSVLNTPAPAPTSLLLNGDFEATAAADIAW
KIRLGGPTYNFMTSDTITAPYSGTQVGSLTYSANSAPFIAMSGQNINLRADTNYKLSAHI
KSSMANPPCSMTFTISQTTGTSVLKVISTTAADAINTEWQEVTGSYLHGSADLTLSINVR
TLCTRTIINPVTFHIDAITFIVV

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
211316	ChtBD1_1	1.06e-11	93	135	1	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	1.23e-11	181	218	7	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	1.48e-11	32	75	1	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	7.28e-10	32	70	1	36	Chitin recognition protein.
211311	ChtBD1	1.47e-09	32	71	1	37	Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD00986.1|CBM18	8.13e-301	1	563	1	563
QRD03434.1|CBM18	2.11e-51	24	242	19	248
QRC98950.1|CBM18	5.97e-48	14	242	14	234
QRC97791.1|CBM18	5.91e-44	24	242	17	232
CAE7028354.1|CBM18	4.86e-36	27	235	22	232

PDB Hits     

QRD00986.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0DKH7|AMP1_FAGES	6.17e-06	31	70	1	37	Antimicrobial peptide 1 OS=Fagopyrum esculentum OX=3617 PE=1 SV=1
sp|P0DKH8|AMP2_FAGES	6.17e-06	31	70	1	37	Antimicrobial peptide 2 OS=Fagopyrum esculentum OX=3617 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000242	0.999721	CS pos: 20-21. Pr: 0.9843

TMHMM  Annotations     

There is no transmembrane helices in QRD00986.1.