CAZyme Information: QRD00921.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD00921.1
• CAZy Family: GH18
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2I2H9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
655		74616.95	8.7936

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069033:980365-982383(-)

Full Sequence      

MQPTSNSTRSSTPSSSQESVHDEITTVRETPTPPLSARLSPAQRSQSSLMSTFTNDVQSR
PMSRQATRTSRKSPTTARPKILPLQSATSSKETVSRSFRSPSASSSFYYVKKPPMASAVP
LGSSADPEDIKEFLALAEQRQKAFEPNKYSSYAWQMFWFVMILCITYFGFIGFPIWDGIC
YSLWKWLKFGNHVTMGVLIFFLWGASISWLPQLFVKFEKNAEPLDPESPVPRTDASETCL
LIPAYKAAGALPETIEYALKIFKPDQIFVLANGNSPTPLDNAEDVCKEYGINHAWIPVGS
KIIAEFVGVMLAKKFKYAMLIDDDVHLPANLPIVTDRISDTKAHRSTVCIGYTIKSTGAN
GSKGTYIQQAQDLEYKLSGLSRHFQGTYGSATFPHGAIILWNRDILEKLFWGHPGYKISE
DWYFGHTCRSAGYRIEFCSQVFVETETPPSLFVPVKSTRGGYGEMTVWKQRFYRWNFFYL
YRLRDDFNYLIFAWRLGHYEFITKVFVLSEIVETFIYFSRPFMLPIALWVQPKMVGIMTA
ALFGVYVVGVLFFNAVHLRYKKEMIAWKVVPVYFLMKMALTFVNTVSVYYSLYAYAAFFA
HRHPRVTESFSALTAAQSCLDIEAEKQRVIIREEMLEVHEDEELELARPVPAKLQ

Enzyme Prediction     

No EC number prediction in QRD00921.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	318	551	3e-20	0.9847715736040609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404520	Glyco_tranf_2_3	1.09e-18	240	475	6	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
404513	Glyco_trans_2_3	1.40e-18	317	552	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	1.74e-05	240	421	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
223539	WcaA	5.26e-04	240	520	7	288	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD00921.1|GT2	0.0	1	655	1	655
QLI64086.1|GT2	6.84e-146	126	627	129	639
CAE7014388.1|GT2	3.31e-144	159	613	280	730
BCR93365.1|GT2	6.26e-140	137	613	176	652
BCS06011.1|GT2	6.26e-140	137	613	176	652

PDB Hits     

QRD00921.1 has no PDB hit.

Swiss-Prot Hits     

QRD00921.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

Start	End
157	179
189	211
505	524
534	556
569	591