CAZyme Information: QRD00626.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRD00626.1
• CAZy Family: GH18
• CAZyme Description: Glycosyltransferase family 32 protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2FCV7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337		39254.13	9.2488

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069033:412951-414064(-)

Full Sequence      

MKRGVTIFILVTVVVLGFAVHSVWTLLGLLVATGREDAILRGELPAPNSGTVNDRPQLIP
KIIHQTYKNDSIPEHWKGPQQSCLDLHPDYEYKLWTDKKSREFIAAEYPWFLETFDGYPY
PIQRADAIRYFVLHHFGGIYIDLDDGCNRSLDPLLAYPAWVRRTLPTGISNDVMGSIPRH
PFFLKAIDSLTDYNRRWPLPYITVMASTGPLYLSIVWRHFNNANPEGDNRVRILFPDEYN
NHSWSFFTHHVGNSWHRTDVKVIFWLARHWVFVTILGFALGFTLLGFLYKIFVLNKLPSS
PRMSPKARALDRFAYTRIPFYRRISSKDFELEDRHEV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	75	155	2.4e-23	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.75e-79	54	327	77	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.43e-28	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD00626.1|GT32	1.02e-260	1	337	1	337
CBY00993.1|GT32	1.08e-221	1	337	1	337
CAE7009206.1|GT32	5.77e-218	1	337	1	332
QDS70160.1|GT32	2.26e-153	2	325	3	318
BCS14035.1|GT32	1.42e-150	1	330	1	342

PDB Hits     

QRD00626.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	6.58e-105	1	285	1	281	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	5.71e-102	1	285	1	289	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	6.36e-91	44	284	65	310	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	2.04e-89	48	289	46	288	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	7.90e-59	59	285	64	291	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.943853	0.056178

TMHMM  Annotations     

Start	End
7	29
271	293