CAZyme Information: QRC99776.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC99776.1
• CAZy Family: GH16
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2F711]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		45741.60	4.5488

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069032:497587-498819(-)

Full Sequence      

MSYLPALLLPLAALLTPTLAADSYVSSNSETPKDNNGNCSCYVVSTGDNSDTPQYFQYYR
FYDFRNLAGGFDTAPPLINDTQNASALSTWQPSIFNSDNWISDWGIQNWSKPATDDFPVP
LTNSYANIYMGEEDNSTFLTLRTSRHNDHQTAGEIENQQKNLMHVSMRMYGRVVGDPGAV
AGFFTFYDDSNESDIEILTRDPKDQTRYTNQPSVDKSGNEIAAASTGPTNLAPWDEWQTH
RIDWLPKDSFWYLNDKQVAANTYSVPRKPSYLVLNMWGDGGEWSGNMTVGDHAEFQIQWI
EMTFNTSGPYTGSQKADKRDVMEKRGRKTCGNVCKIDDVKQLGTPEIVSYGVDGEEDDGL
SAGAKAGIAIGVILGVALLAAIAWFFWRKRRATSVTKSKEGYELTADQRR

Enzyme Prediction     

No EC number prediction in QRC99776.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	103	302	1.5e-79	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	2.03e-51	96	303	5	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	6.15e-06	177	303	81	211	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
404943	DUF4307	0.001	368	409	6	47	Domain of unknown function (DUF4307). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 132 and 153 amino acids in length. There is a single completely conserved residue C that may be functionally important.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC99776.1|GH16_22	2.85e-304	1	410	1	410
CAE7012560.1|GH16_22	2.65e-184	1	354	1	360
CBX92358.1|GH16_22	3.21e-181	4	351	7	347
BCS21543.1|GH16_22	3.38e-76	42	307	21	289
QSZ31251.1|GH16_22	6.36e-72	33	348	24	343

PDB Hits     

QRC99776.1 has no PDB hit.

Swiss-Prot Hits     

QRC99776.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000191	0.999800	CS pos: 20-21. Pr: 0.9804

TMHMM  Annotations     

Start	End
368	387