CAZyme Information: QRC99164.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC99164.1
• CAZy Family: GH154
• CAZyme Description: Choline dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A0A7U2I292]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637		69074.25	8.6380

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069031:959405-961370(+)

Full Sequence      

MGSLVQAIFFFNSFLPNTWFAAEPQSNYGEQSLNGKTFDYVIVGGGLTGLVVANRLSEDK
DRTVLVLENGGISDDISTQVPSFANSINSRLMYDITSAPDANTGGKTYPVYVGNVVGGGS
VVNGMAFDRASAADYDAWEQLGNIGWNWNSLLTYFKKSTTFTPPSQAHAQEFGITYDASY
YGTNGPVHASFPNFEYDDTKNIWAAYKAENIALPKEHAAGLAVGAFWTPTALQPDTQTRS
SAKNAYYDPAKSRSNLVLATGKKVNEVLFDQGLFSMISPKATGVQYVSKADGSVGKVYAK
REVILAAGSVFTPQLLQLSGIGPRDVLQAAGIKVKRDLSSVGANMQDHPNANVMFDLKNL
AKVNIFSGQDPASNQSAWNDYKSKKNGPLTQAHGSSLAFLSLNSITDKASQIVQTIKAQN
ILSVLPGIYSKDQNLLRGILKQRDIIANLHASLKSAVGEIPMTPFGLAISALQRPLSRGS
INIDPKNKYGNPIVQFNTFSNPVDRQIIVEMVRWTRRHWAKKELAMYSPIEISPGAQFQT
DDDIIDALIQQNGLSASFAHMSGTCSMMPELLGGCVGSDLKVYGTQQLSVVDASIIPLVP
ATHLQATMYAVAEKAADIIKARNAVGDLFPTFRFWRR

Enzyme Prediction     

No EC number prediction in QRC99164.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	36	621	2.6e-171	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.07e-84	36	622	4	534	choline dehydrogenase; Validated
225186	BetA	5.72e-74	35	624	5	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	6.90e-35	475	615	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.19e-24	125	349	36	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.34e-18	245	608	228	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC99164.1|AA3_2	0.0	1	637	1	637
CAE6996591.1|AA3_2	6.77e-311	1	630	1	626
QRC97861.1|AA3_2	4.90e-186	26	622	8	600
QRC90410.1|AA3_2	1.44e-180	38	622	30	614
QDS73255.1|AA3_2	4.16e-180	28	622	12	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	3.92e-104	38	623	6	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	7.80e-88	38	619	36	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6XUT_A	1.05e-69	33	621	12	589	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
4YNT_A	1.89e-66	33	620	1	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	6.04e-61	38	621	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	1.11e-98	30	623	30	617	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	1.66e-84	33	619	42	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.66e-84	33	619	42	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.15e-67	37	623	40	611	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	3.42e-62	32	620	34	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.868452	0.131564

TMHMM  Annotations     

There is no transmembrane helices in QRC99164.1.