CAZyme Information: QRC98882.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC98882.1
• CAZy Family: PL3
• CAZyme Description: Apple domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2F534]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474		54580.15	6.5899

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069031:384762-386186(-)

Full Sequence      

MISKTRNEKRPHWEKPMRSSFTVRRYGHLKIITALVLIFVLFYERFVPTAKFDIHYQLDL
HPLECPTAPITDEILVVLRTGATEALEKLPVHFDTTLKCVPNYVIYSDYEGAIQGHKIHD
VLDEVSSDLKRSAPEFKLYSDLKIGGRSSLLPTEHSGSGPSGSLENPSWKLDKFKFLPMV
DRAFRHGPDAKWFVFVEADTYLMWTNLVAYLGKLDASKELYIGKHMFIGDVLFAHGGSGF
ALSAAAMRKVTEHWRDNIDEYDQYTTENWAGDMVLGKVLRDVGVQLFWAFPHFQGDPVSA
LDHNVLKVERRPWCYAPITYHHMRDADVRQLWDFEQAWQRKRKGALSHRVVFKEFILPRL
ATRHDNWDNLSVNLEPGNTTSLDDCRALCQTKATCLQYKYATNSCFTSDEVRFGEEAWKS
CLEYSVAASKCVRWQDGTQETDEVQSGWMLDRLPQYVDKMDSLCDGAEDVKWVV

Enzyme Prediction     

No EC number prediction in QRC98882.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238533	APPLE_Factor_XI_like	2.54e-04	361	406	6	53	Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.
215605	PLN03153	2.75e-04	166	261	186	288	hypothetical protein; Provisional
367085	Fringe	0.002	188	250	83	159	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC98882.1|GT31	0.0	1	474	1	474
CAE7218201.1|GT31	7.76e-119	57	464	47	452
CBX97542.1|GT31	5.14e-118	63	464	52	451
QRD02545.1|GT31	9.93e-117	59	469	43	450
QRD94340.1|GT31	1.52e-113	24	414	4	395

PDB Hits     

QRC98882.1 has no PDB hit.

Swiss-Prot Hits     

QRC98882.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000004

TMHMM  Annotations     

Start	End
26	43