CAZyme Information: QRC98638.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC98638.1
• CAZy Family: GH135
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
895	CP069030|CGC4	98587.27	4.7782

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069030:1727341-1730421(+)

Full Sequence      

MATMNLGIANPTQGDLRQIELKQATIQVQPVTIDTPATTPEQNSPSEEAMTGKKVFSLER
PMDKARELAAKLTLEEQVSLLAGADFWRSKAIPEKGIPSIKTSDGPNGARGEFFTNGTPA
ALFPCGISMASSWNVDMMEEIGRHLGDECKARGADVLLAPTICMHRSPLGGRNFESYSED
PFLTGKLAASYVRGLQSKGIAATIKHFVGNEQETERQAYDAIIAERPLREIYLKPFEIAV
REASPWALMSAYNMVNGQHADEYVHSIKEILRGEWGWEGTIISDWTGTYATAPSIKSGVD
IEMPGPSKWRKFEQVKECLDNGELDVEDVEEAAARVLYLVERTKGFNNMTPEEPEKSIDN
PETRALILQAGIEGLTLLKNEGNVLPIKNAKKVAMIGPNVKRSIASGGGSAGLNPYYKTT
PWDGVQNRFKGEVTFAQGCDSAKWLPLASPYCKTENGETGVRLEYYRGDRFKGEPEVVQH
KVSTDLWLWDSAPMELLPDFSFKVKTTLTPQSTGKHSFSFASVGPGRMFIDGELFIDNWD
WVEEGEAMFSASEDVLKSVELEEGKPVEILIESTSEVRPASKVSTLGRRYDYGGCRIGYQ
EEDKIDRIQEAVDAAKEADVAILVVGLDAEWESEGYDRQTMDLPKNGSQDRLIEAVLAAN
PRTVVVNQSGTPISMPWVHKAPAILQAWYQGQEAGNALADVLFGNASPSGKLPTTFPVRI
EDNPAYHNWPGENLKTVYGEGIYVGYRHYERSKIAPLFPFGHGLTYTTFEYGTPTVSATV
LTEAGEIVVTVPVTNTGRVAAHEIVQAYVKDIKSTLPRPEKELQAFGKVFLQPGETKNVN
LKLNKHSVGYFDTSLGQTGAWIAEEGTFEVLVGASSADIRSKVSFEVKESFQWIF

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	91	304	2.4e-64	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.35e-86	123	886	120	763	beta-glucosidase BglX.
224389	BglX	3.40e-66	85	412	48	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	7.94e-62	375	746	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.97e-42	64	841	52	740	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.01e-40	96	339	65	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC98638.1|GH3	0.0	1	895	1	895
CAE7001702.1|GH3	0.0	1	895	1	898
QDS68320.1|GH3	0.0	78	880	39	837
AEO66128.1|GH3	0.0	65	895	59	888
UQC88307.1|GH3	0.0	65	895	54	873

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.21e-202	67	893	8	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.74e-198	67	893	8	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.13e-152	66	890	6	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.74e-120	72	881	12	657	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	5.46e-117	62	889	1	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y3M6|BGLI_ASPFC	9.54e-229	71	894	12	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	3.81e-228	71	894	12	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	2.70e-227	70	883	16	834	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q2U8Y5|BGLI_ASPOR	3.14e-227	71	894	12	837	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	1.94e-225	71	894	12	836	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000002

TMHMM  Annotations     

There is no transmembrane helices in QRC98638.1.