CAZyme Information: QRC98260.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC98260.1
• CAZy Family: GH13
• CAZyme Description: alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276	CP069030|CGC10	30398.00	4.3551

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069030:983055-984081(-)

Full Sequence      

MPLAPTDAPVWDIDLFDNPASTMATLKASGKIVVCYFSAGTAEDWRDDYRDFAAADLGKV
LPEWPNEKWIRTGSQSIRNIMAKRIKLAADKGCDAIDPDNTDGYQNDNGLKLTSSDAINY
MLWMQAEAKKYNMKIGLKNSLDIVSSLASTVDFAVNEQCAALGECRAYEQFLALNKPVFH
IEYPTPLNAQAAKGVSCTSVGVNGTSTILKNLQLDGDTHPPTEAFETTNDAYTELFSSCD
TSQTIDHDTTFSAAAEPSLVNAKTAYEYTGWWKWWV

Enzyme Prediction     

No EC number prediction in QRC98260.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	6	183	9.6e-69	0.9315789473684211

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	1.36e-96	5	216	14	221	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	1.66e-27	12	183	84	266	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
225219	COG2342	0.009	25	183	68	251	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC98260.1|GH114	9.24e-206	1	276	1	276
EAT88101.2|GH114	9.23e-201	1	276	1	274
CBX95203.1|CBM0|GH114	3.14e-114	1	216	41	256
CAE7002609.1|GH114	3.14e-106	1	216	41	270
QKD54655.1|GH114	7.64e-78	10	216	116	328

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	5.79e-65	7	215	56	271	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	9.60e-65	7	215	73	288	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

QRC98260.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QRC98260.1.