CAZyme Information: QRC98208.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC98208.1
• CAZy Family: GH13
• CAZyme Description: Alpha-1,6-mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A7U2F5X3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
450	CP069030|CGC2	52919.94	9.9978

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069030:884161-885606(+)

Full Sequence      

MSRSPSPRPGGWSSPGLSTPYDGSGRTSPFANGSSSHNVTWASAQARSAEVKSNSGFNPR
GQGFFTKHFRRISTSLPMSYGDKEKVGRGRYQNNKFMQFLNRIAWNIWRLRRSLGVVLFI
VFSIIMFYVTPLHRIYRRSAIGGGGSKYVVILAVNQGGGVMEWKGPREWAIERDSVKNKK
KYVKKWGYELESVDMSTKKRYAHEWRESWEKVDTIRNAMRKYPHAEWFWWLDTNTFIMEP
SKSLQSHIFKRLDKITYRDINTYNPLNITHPLTDDYLDPETRSPVGDGKVDSINMLVPQD
CGGFNLGSFMLRRSVWTDRLLDIWWDPVGYEQKHMEWEHKEQDAFEYMYQNQPWIRPHVA
FIQQRQIMSFPPGACGEQGDNPNIHYSEKERDFLVNMAGCEWGRDCWAEMYNYRQLSNRL
NRNPWEKFKDGISEFFEKKKKKKEEEQKKN

Enzyme Prediction     

No EC number prediction in QRC98208.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	147	408	2.6e-84	0.983739837398374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	1.42e-69	146	406	3	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215616	PLN03181	0.007	209	234	183	208	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC98208.1|GT34	0.0	1	450	1	450
CBX95305.1|GT34	2.50e-276	1	437	127	563
CAE7002066.1|GT34	1.54e-270	1	438	1	438
QDS68167.1|GT34	1.62e-212	1	432	3	442
VDB93754.1|GT34	7.88e-193	1	438	3	456

PDB Hits     

QRC98208.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P50108|MNN10_YEAST	2.01e-98	147	428	121	390	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|P78817|YFE6_SCHPO	2.37e-81	146	427	73	342	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|O94622|YBKD_SCHPO	8.11e-25	173	437	125	368	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	2.42e-21	176	425	128	358	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q10359|GMH3_SCHPO	1.94e-16	176	415	112	329	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000001

TMHMM  Annotations     

Start	End
114	136