CAZyme Information: QRC97449.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC97449.1
• CAZy Family: GH105
• CAZyme Description: Glycoside hydrolase family 2 protein [Source:UniProtKB/TrEMBL;Acc:Q0UHK0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
681	CP069029|CGC6	76517.99	5.5020

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069029:1071386-1073431(+)

Full Sequence      

MADDYPRPDFVRESVQWRSLDGPWSFLFDDNDVGLSQSWHLKGLPQEITVNPTNTNSSDK
SGAPDIVAKIAAGTQELLKDNIFKGHEAVVNKKRDIQVPYVFQCPASGINELGVHEVLWY
EREVEDLRSEEQKLAGHRVVIRFGAVDYEAKVWVGGQFFGGHRGGHVPFDIDITDAFVSG
KTQRLALRVFDSAHDLTQPRGKQYWKAQPESIFYTPSGGIWQTVWLESVPTVRIGDASTG
TVLKSNDIESGKLVGEIKVLGRPAGHAFGVEIEASLEGVAIGKTERLELPRDSDIVSIET
NMKLSKTQQEEVTKSAPYLASGKCWHNGVALWSPEHPTLYDITIRLYSSSSALIDTIHTT
TGMRSLSWSTADGTFRLNNQPYFQALFLDQGYWPDTFMTPPSTSALKIDIELSKKMGFNG
CRKHQKVEDPRFLYWADRLGFLVWGEMANAYAFSAEYVERFDQEWREAVMRDINHPSVIA
WTPVNESWAYTDLQGDVRQRNHIRSLYYATKTMDPTRPVNDNCGWEHVKTDLTTFHDYAD
ADALMETCKTMDGILGAHGGRPLFLDATGDDPGSSHMSNAPVICTEFGGINIARSAVEAG
GQRDWGYTTATDPKDLLKRIEKMMMGIVDGGHIGGFVYTQLTDIEQEVNGLYTLDRKEKL
DSTEVRKIVEHVKERYRTMHK

Enzyme Prediction     

No EC number prediction in QRC97449.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	13	673	1.6e-94	0.6183510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236657	PRK10150	2.07e-35	13	519	8	445	beta-D-glucuronidase; Provisional
225789	LacZ	1.77e-31	1	520	1	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236673	ebgA	1.05e-21	136	519	125	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	2.23e-13	18	190	2	134	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
397119	Glyco_hydro_2_C	3.80e-12	409	519	41	158	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC97449.1|GH2	0.0	1	681	1	681
CAE7200486.1|GH2	0.0	5	681	9	691
QPC68042.1|GH2	1.18e-304	5	670	3	675
QKD54841.1|GH2	4.62e-304	5	670	3	674
SCB64422.1|GH2	9.65e-304	5	670	3	675

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	4.32e-55	82	668	51	578	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
4JKM_A	1.22e-20	118	519	69	444	Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]
6LEM_B	1.90e-18	18	519	11	439	Chain B, Beta-D-glucuronidase [Escherichia coli]
6LEJ_B	1.91e-18	18	519	13	441	Chain B, Beta-D-glucuronidase [Escherichia coli]
4JHZ_A	1.91e-18	18	519	15	443	Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12],4JHZ_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P77989|BGAL_THEP3	1.49e-19	117	502	57	404	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|O18835|BGLR_CANLF	8.30e-18	5	519	29	478	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
sp|P05804|BGLR_ECOLI	9.84e-18	18	519	13	441	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
sp|T2KPJ7|PLH8_FORAG	1.69e-16	119	517	106	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|O97524|BGLR_FELCA	4.12e-16	107	519	81	478	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000002

TMHMM  Annotations     

There is no transmembrane helices in QRC97449.1.