CAZyme Information: QRC97346.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC97346.1
• CAZy Family: GH10
• CAZyme Description: Carbohydrate esterase family 5 protein [Source:UniProtKB/TrEMBL;Acc:Q0UH92]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324		32696.52	4.4381

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069029:855795-856821(+)

Full Sequence      

MLNIRNTIALGAISTLAAAQTTAPKLDAQCADVVIFMARGNDAPYHDGRTTPFIDATCAK
LNGQGKSCDYIDIQFDVTLGGDYCAQVAEGARNGQSQIAAFQAKCPCTHIVVNGYSQGAH
VVGDVLGGPGGCTKVSNGIDNNSAAGKAIAAALIWGDVMHTANQPYNVLDGADKQKNPRP
AEDLALLNRYAGVLRAYCAAGDPVCAGGNNVADHLNYFELYTDDASSWVVGKIDGTADLC
PAASSAPLPSATAPASSGAPAVTASASGSSVGAPVVTATAEGSTVAPESTPCTSSAPAVT
PAPFPPAVEYGTCVQAVEVVTVYA

Enzyme Prediction     

No EC number prediction in QRC97346.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	29	232	1.6e-36	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	8.57e-16	29	233	1	173	Cutinase.
411474	fibronec_FbpA	7.99e-05	222	305	153	228	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
411474	fibronec_FbpA	9.89e-05	242	307	196	259	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
411345	gliding_GltJ	1.99e-04	241	307	423	490	adventurous gliding motility protein GltJ. Adventurous gliding motility protein GltJ, also known as AgmX, occurs in delta-proteobacteria such as Myxococcus xanthus.
411474	fibronec_FbpA	2.52e-04	242	308	231	288	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC97346.1|CE5	4.81e-207	1	324	1	324
QRC91682.1|CE5	5.86e-114	4	253	5	254
CAE7188760.1|CE5	1.58e-102	4	244	4	242
CAE7028068.1|CE5	1.11e-92	7	233	13	243
UPL04270.1|CE5	1.84e-59	27	238	22	235

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	8.25e-17	30	233	2	206	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	8.25e-17	30	233	2	206	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	8.25e-17	30	233	2	206	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1QOZ_A	3.09e-13	83	233	57	206	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
7CY3_A	4.00e-06	30	233	17	193	Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY3_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY9_A Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9],7CY9_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	6.92e-16	30	233	29	233	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	2.07e-12	29	233	32	237	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	2.63e-12	83	234	80	230	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|O06319|CULP4_MYCTU	5.51e-10	12	233	29	226	Phospholipase Culp4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut4 PE=1 SV=3
sp|B9U443|CUTI1_COPCI	1.50e-08	7	233	8	199	Cutinase CUT1 OS=Coprinopsis cinerea OX=5346 GN=CUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000363	0.999624	CS pos: 19-20. Pr: 0.9620

TMHMM  Annotations     

There is no transmembrane helices in QRC97346.1.