CAZyme Information: QRC96557.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC96557.1
• CAZy Family: CE4
• CAZyme Description: Carbohydrate-binding module family 18 [Source:UniProtKB/TrEMBL;Acc:A0A7U2F0U7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641		66903.32	6.1631

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069028:1556495-1558471(+)

Full Sequence      

MKYLTLAAGLLSLGLAQAQKVSTDGSCGGSSSVTCKGSGFGDCCSQYGWCGSSIDHCGSS
CQSQFGTCSGSDSSPTTKRTSSTLTVRTSTLQSAAAASTPTTKVSTDATCGSSNGGATCL
GSEFGDCCSKSGWCGSTSAYCGASSCQAGFGRCEGTAAPSSTRPATPPSASGASLALQCL
NDKNVPYKMTSDAEYADLIEPYNTRLPFFPAVVVLPTTNQHVQDAVVCAGKSGLKVQAKS
GGHSYSSTGLGGKDGSMSINLQSLQTVQLDTSSGIATVGGGVRLGNLADALWNQGKASIS
HGTCPGVGIGGHYTHGGYGPTSRNYGLAMDQIVAADVVLANGTLIKATSTAYPDIYWAVR
GAADSFGIVTTFYLQTRPAPASITYFAFPFAGVFDSKTKFTNTFLHLQDVAKNASVVDDK
ISFGIYLDGYGTFSLSGAYFGSVADFNSKVKTELLRGLPSSTATVESMNWYDYLVKLSGE
STLKTSVTGYDVHDDFFAKSVTVPESDGLASNTMDALYDYLKTADGTDYYMIINLYGGPG
SAINSKDTNFAAYNDRDSLWVLQNWGYGGNSVDFINGINSAIINAQPQTKFGAYLNYVDP
SYDAATAHKLYYGDAVYSRLAALKKQVDPQSVFWHPQAIGA

Enzyme Prediction     

No EC number prediction in QRC96557.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	201	414	1.8e-74	0.4497816593886463

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	3.40e-23	210	348	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	1.07e-20	203	400	25	227	FAD/FMN-containing dehydrogenase [Energy production and conversion].
211316	ChtBD1_1	4.65e-16	26	68	1	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	7.72e-14	109	154	1	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
369658	BBE	4.67e-10	593	640	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX96933.1|AA7|CBM18	6.59e-293	1	640	1	643
CAE7194773.1|AA7|CBM18	9.77e-252	95	641	19	566
BAI44126.1|AA7|CBM18	2.52e-164	20	639	86	716
QBZ61916.1|AA7|CBM18	2.01e-163	20	639	86	716
APA09402.1|AA7|CBM18	5.89e-147	179	641	46	520

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	3.86e-88	178	639	29	492	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
3RJ8_A	7.65e-83	179	639	6	469	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
6YJO_A	4.78e-80	160	639	18	501	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
6Y0R_AAA	4.85e-76	179	639	30	488	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
6EO5_A	3.69e-63	178	639	16	468	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QG48|XYLO_MYCTT	1.99e-87	178	639	29	492	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	7.16e-82	179	639	28	491	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|I1S2K2|CHITO_GIBZE	2.49e-75	179	639	30	488	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|E9F5F1|SUBF_METRA	3.31e-70	179	641	32	491	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1
sp|P9WEY2|DPMAF_METAN	4.62e-70	179	641	32	491	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999725	CS pos: 18-19. Pr: 0.9775

TMHMM  Annotations     

There is no transmembrane helices in QRC96557.1.