CAZyme Information: QRC96330.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC96330.1
• CAZy Family: CE4
• CAZyme Description: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase [Source:UniProtKB/TrEMBL;Acc:A0A7U2HY91]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
698		77294.17	5.8224

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069028:1030319-1032483(-)

Full Sequence      

MASILGWKDILRPIRDGYRHLFPTPDTGPSPEERRLQRERDRLKGFEYFDTFDQLEGWEE
SDSDPLQISNTPLLPRIVGTAAKEGPKARVLLVHDYAGNYHDYENVQGADLAEEMYACED
LQYVDSFVYFSHKLVCVPPPTWANTLHRNGVLALGTILVEPQTKETDRFLQHTSSDGNMT
FGLATKLANIAKHYGFDGYLVNIEIPFPREAWSPNILQAFLVQLRDELGDNRQLVWYDAL
TTSNKISYQNALTASNLLFAQACGGILTNYCWGESEASRSKTIALQSGFPPEQIFFGVDV
WAQNNSGSHQSRSTYPKKGGGGTNTGAAVTKLAELGLSAGIFAPAWSFEHFPVQGRAIER
TMWHGDDLPNDVDCSCGNAAVRHQQTQGCCITKSARCFPAGWEMFFFTDFSRSFAKHVTD
GPLHAQLGAQAPLPIPVPCVNQGSQARIAHRLAQGPQSKLVIEAHNCIQADVLTQYFDCY
IPLYSLNMPAVGGLALEVTYRNLATDTGAVPSLSLKLINRDEPRLLPIEDNGGVHTMRAK
IGPQTDTDEGGGLKELGFHLTGFGGEGTVPILEIYTISITPLQSDNVPHVHSIYEVQLQH
RGEGENKHVRLCWKFTGTTEDRLSGIPYSHLTGPFSYFLVNINGTQCGRTYTLESILTKE
MQKTFTEKELEVEIIGVGFVGQNLARHVTALHLSSELI

Enzyme Prediction     

EC	3.2.1.96:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	97	412	3.7e-72	0.9714285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397623	Glyco_hydro_85	1.64e-92	113	412	5	288	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
119364	GH85_ENGase	9.42e-84	91	435	1	330	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
227068	COG4724	3.85e-24	53	348	37	330	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC96330.1|GH85	0.0	1	698	1	698
CAE7196105.1|GH85	7.16e-235	1	693	1	701
CBX96940.1|GH85	3.33e-224	1	685	1	692
SMR47729.1|GH85	1.90e-130	37	684	19	669
SMR46481.1|GH85	1.90e-130	37	684	19	669

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FHA_A	6.17e-22	53	365	14	324	Chain A, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHQ_A	8.17e-22	53	365	14	324	Chain A, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
2VTF_A	1.46e-21	53	365	19	329	X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]
2W91_A	2.77e-17	49	344	14	306	Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D. [Streptococcus pneumoniae TIGR4],2W92_A Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D, in complex with NAG-thiazoline. [Streptococcus pneumoniae TIGR4]
3GDB_A	3.77e-17	49	344	165	457	Crystal structure of Spr0440 glycoside hydrolase domain, Endo-D from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0C7A1|ENASE_CHICK	7.04e-40	2	375	42	395	Cytosolic endo-beta-N-acetylglucosaminidase OS=Gallus gallus OX=9031 GN=ENGASE PE=1 SV=1
sp|A1L251|ENASE_DANRE	1.23e-38	51	363	67	362	Cytosolic endo-beta-N-acetylglucosaminidase OS=Danio rerio OX=7955 GN=engase PE=2 SV=1
sp|Q8BX80|ENASE_MOUSE	1.88e-38	24	349	58	360	Cytosolic endo-beta-N-acetylglucosaminidase OS=Mus musculus OX=10090 GN=Engase PE=1 SV=1
sp|F4JZC2|ENAS1_ARATH	6.12e-37	43	349	32	307	Cytosolic endo-beta-N-acetylglucosaminidase 1 OS=Arabidopsis thaliana OX=3702 GN=ENGASE1 PE=1 SV=1
sp|Q9SRL4|ENAS2_ARATH	2.36e-35	87	349	67	312	Cytosolic endo-beta-N-acetylglucosaminidase 2 OS=Arabidopsis thaliana OX=3702 GN=ENGASE2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QRC96330.1.