CAZyme Information: QRC96238.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC96238.1
• CAZy Family: CE4
• CAZyme Description: Glyco_hydro_32N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2HZC2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525		58676.81	5.9997

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069028:867670-869247(+)

Full Sequence      

MMPSATQASPVRYSRPSESQAAADAIPILIDHEYHIFHLSTPPDTVRHPTRLRSTWSRLR
SRDLVTWARDEVEALYPGKSPDSPDADGAWTGSAIVGPDGNMHLFYTGYNLSQHGKQVIL
HAQSSDKQGSVFTKIPSPITISGDMSLFEDIDFRDAHVSWNEPESCYWMIVATRLRSGPY
WTRGCFALLTSSDLDEWSIEATPFYAPNNMFCPECPEIFSLPNGKWYLVYSRFHAPDSGT
VYRVADAPRGPFRTPRGSSGGRFDGRRWYAAKSCVKASDPNRRVYFGWVADKLDGQWSWG
GDMGMPREISANKDGLLIVEPSREFIDAYFRHGAVSELPSELTLSSVGMTISRDLRLGDR
SDYLLEFGIACQDAASFGLLFRTDEDNKGLQLRFTPTQNGLLDTSLLSCPPPLDDFWADQ
YALHLPREVDGPELARHTSLKIEGSIVVAVRSDVLEIFAGGKSLSYRLPCTRYAEGSHRT
EQVKHTANGALRHDSPRVKELGVYVDDGEVALKELSLRYVCSSDR

Enzyme Prediction     

No EC number prediction in QRC96238.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	28	317	2.1e-44	0.931740614334471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
350109	GH32_EcAec43-like	1.28e-118	23	317	1	281	Glycosyl hydrolase family 32, such as the putative glycoside hydrolase Escherichia coli Aec43 (FosGH2). This glycosyl hydrolase family 32 (GH32) subgroup includes Escherichia coli strain BEN2908 putative glycoside hydrolase Aec43 (FosGH2). GH32 enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). GH32 family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize.
350110	GH32_FFase	3.61e-41	27	310	9	280	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
350121	GH32-like	5.01e-40	31	296	18	292	Glycosyl hydrolase family 32 family protein. The GH32 family contains glycosyl hydrolase family GH32 proteins that cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
214757	Glyco_32	3.97e-35	27	402	15	388	Glycosyl hydrolases family 32.
395193	Glyco_hydro_32N	7.76e-31	27	321	15	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC96238.1|GH32	0.0	1	525	1	525
UDD60227.1|GH32	1.99e-197	2	510	1	508
QMS79065.1|GH32	9.95e-196	2	517	1	510
UPL01832.1|GH32	2.82e-188	13	519	17	516
CEI65936.1|GH32	1.91e-183	13	524	17	522

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NUM_A	4.26e-17	34	324	65	358	The structure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]
2QQU_A	9.78e-15	27	324	23	334	Chain A, Beta-fructofuranosidase [Arabidopsis thaliana]
2QQW_A	9.82e-15	27	324	23	334	Chain A, Beta-fructofuranosidase [Arabidopsis thaliana]
2XQR_A	9.82e-15	27	324	23	334	Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_C Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_E Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_G Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_I Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_K Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana]
2AC1_A	9.91e-15	27	324	27	338	Crystal structure of a cell-wall invertase from Arabidopsis thaliana [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q43866|INV1_ARATH	5.56e-14	27	324	70	381	Beta-fructofuranosidase, insoluble isoenzyme CWINV1 OS=Arabidopsis thaliana OX=3702 GN=CWINV1 PE=1 SV=1
sp|Q8W4S6|INV6_ARATH	2.68e-12	34	320	42	339	Beta-fructofuranosidase, insoluble isoenzyme CWINV6 OS=Arabidopsis thaliana OX=3702 GN=CWINV6 PE=2 SV=1
sp|P49174|INVA_MAIZE	1.54e-11	34	320	79	375	Beta-fructofuranosidase, cell wall isozyme OS=Zea mays OX=4577 PE=2 SV=1
sp|A2X5P7|INV1_ORYSI	4.63e-11	34	320	74	367	Beta-fructofuranosidase, insoluble isoenzyme 1 OS=Oryza sativa subsp. indica OX=39946 GN=CIN1 PE=2 SV=2
sp|Q9LIB9|INV5_ARATH	3.26e-10	27	320	61	367	Beta-fructofuranosidase, insoluble isoenzyme CWINV5 OS=Arabidopsis thaliana OX=3702 GN=CWINV5 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000002

TMHMM  Annotations     

There is no transmembrane helices in QRC96238.1.