CAZyme Information: QRC96192.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC96192.1
• CAZy Family: CE4
• CAZyme Description: DUF1680-domain-containing protein [Source:UniProtKB/TrEMBL;Acc:Q0V4B2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620		68122.19	8.6444

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069028:786752-788721(+)

Full Sequence      

MLSITLLTGCLLAVSPAIAQTIPSLAVPEVGTSAYEFDLSQVSLSNSRWKDNENRTLNYL
KAVNVDRLLYNFRATHKLSTNGAQPNGGWDAPNFPFRSHAQGHYLTAWVHCYATLRDNEC
KNRASYFVQELAKCQANNGAAQFSTGYLSGFPESEFVALEAGQLKGGNVPYYAVHKTMAG
LLDAWRIIGDTKARDVLLALAGWVDGRTKKLSSSQMQTMLGTEFGGMNDVLAAIYQLTGN
QQWLTVAQRFDHASQFDPLANNQDRLSGNHANTQVPKWIGAAREYKSTGTKRYLDIAKNA
WDFTINAHTYAIGGNSQAEHFRPPNQISNFLTNDTAEQCNTYNMLKLTRDLWTTDPSSTK
YFDYYERALINHLLGAQNPTDNHGHITYFTPLKSGGRRGIGPAWGGGTWSTDYNSFWCCQ
GTALETNTKLMDSIYFYDSSALYVNLFTPSTLDWKQRSVKISQVTTFPASDTTTLTVTGT
GNWAMKIRIPSWTSGATISINRQASGVAANPGSYATLSRDWKSGDIVTVKLPMKLRTVAA
NDNANIAAVAFGPVILSGNYGQQALNSMPSLALNTVRRTSTDSLAFTATANGQAVNLGPF
YDAHNINYNVYWTTSGSFSN

Enzyme Prediction     

No EC number prediction in QRC96192.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	41	556	5.3e-197	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400342	Glyco_hydro_127	4.71e-155	41	537	1	479	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
226063	COG3533	3.83e-96	39	536	14	479	Uncharacterized conserved protein, DUF1680 family [Function unknown].
406713	DUF4986	0.004	565	612	26	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC96192.1|GH146	0.0	1	620	1	620
SCF17253.1|CBM13|GH146	0.0	28	616	43	633
SCG50454.1|CBM13|GH146	7.64e-314	28	616	41	631
BCB89999.1|CBM13|GH146	1.64e-313	16	614	22	621
SCG45353.1|CBM13|GH146	4.77e-311	16	616	33	635

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.62e-97	37	612	28	648	Chain AAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.16e-92	37	612	28	648	Beta-L-arabinofuranosidase [Bacteroides thetaiotaomicron]
4QJY_A	1.06e-15	104	572	82	571	Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.31e-14	104	572	82	571	Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

QRC96192.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000485	0.999515	CS pos: 19-20. Pr: 0.9672

TMHMM  Annotations     

There is no transmembrane helices in QRC96192.1.