CAZyme Information: QRC96157.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC96157.1
• CAZy Family: CE3
• CAZyme Description: chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
146		15708.62	5.6430

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069028:674079-674519(+)

Full Sequence      

MGVALDYIIYMTYDLHGQWDYGNKWTSPGCPNGNCLRSHVNLTDAINSLSMIAKAGVASN
KVVVGVTSYGRSFKMAQAGRTGPKCLFTGSFGQSNAAKGEYTDTAGYISNAEIDSIISKG
VSQQYTVEDSNIIMYGDGTEWVAYMA

Enzyme Prediction     

EC	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	3	144	5.5e-16	0.3614864864864865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119357	GH18_zymocin_alpha	3.19e-69	1	145	173	317	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
214753	Glyco_18	1.01e-14	5	113	176	275	Glyco_18 domain.
119351	GH18_chitolectin_chitotriosidase	1.47e-11	5	144	180	312	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
395573	Glyco_hydro_18	7.46e-10	4	144	166	278	Glycosyl hydrolases family 18.
119365	GH18_chitinase	2.21e-08	5	74	201	267	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC96157.1|GH18	5.00e-105	1	146	1	146
UKZ82482.1|CBM18|CBM50|GH18	8.97e-63	1	145	688	832
AIT18867.1|CBM18|CBM50|GH18	4.93e-61	1	146	471	616
QYT01306.1|CBM18|CBM50|GH18	4.52e-60	1	145	773	917
QLI73538.1|CBM18|CBM50|GH18	3.96e-59	1	145	774	918

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1E9L_A	1.48e-09	4	144	182	315	The crystal structure of novel mammalian lectin Ym1 suggests a saccharide binding site [Mus musculus],1VF8_A The Crystal Structure of Ym1 at 1.31 A Resolution [Mus musculus]
6JM8_A	7.01e-09	5	132	185	306	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis]
6JM7_A	7.01e-09	5	132	185	306	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
1SYT_A	8.01e-08	5	144	177	306	Crystal structure of signalling protein from goat SPG-40 in the presense of N,N',N''-triacetyl-chitotriose at 2.6A resolution [Capra hircus]
1LJY_A	1.09e-07	5	144	177	306	Crystal Structure of a Novel Regulatory 40 kDa Mammary Gland Protein (MGP-40) secreted during Involution [Capra hircus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	2.92e-14	4	144	555	685	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|P36718|OVGP1_PAPAN	8.36e-11	1	144	201	331	Oviduct-specific glycoprotein OS=Papio anubis OX=9555 GN=OVGP1 PE=2 SV=2
sp|Q95M17|CHIA_BOVIN	6.88e-10	5	144	204	336	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|Q12889|OVGP1_HUMAN	1.36e-09	1	144	201	331	Oviduct-specific glycoprotein OS=Homo sapiens OX=9606 GN=OVGP1 PE=2 SV=1
sp|Q62010|OVGP1_MOUSE	1.86e-09	1	144	201	331	Oviduct-specific glycoprotein OS=Mus musculus OX=10090 GN=Ovgp1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999164	0.000850

TMHMM  Annotations     

There is no transmembrane helices in QRC96157.1.