CAZyme Information: QRC95872.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC95872.1
• CAZy Family: CE12
• CAZyme Description: cutinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	CP069028|CGC11	34605.40	6.8279

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069028:139249-140364(-)

Full Sequence      

MKYHAAQVFALASIATAFPHPQLPSLPSFSLPTGGLGSGTGTGLGTGLGSGLGSGLGSGL
GSGLGSGLGGGSSPLPTGLPSLGGGFSLPTGLPSLSGGSTGTSGSGLSGWLSSLGGGSSG
GLGGLGGGLGGLGGGAGGASTTADAVVPAPSNTGAAAAPPATGGGNTGGAGTIGTNCKPQ
SGSANAFGGSENGIVDKSCCTDMTIVFARGTGEMGNVGSVSGPPMFKAIRQKLGNDRVTV
QGVDYAASAAGNANLGGDGGQKMADLVKQAKSQCPETKVIVSGYSQGAMVVHNAFSKGLS
ATDVSGAVMFGDPLKRQAISGLSAEKIKEFCGDADQICGGGGDGGATGSHLSYGSSADAA
ASFAIQAAGLA

Enzyme Prediction     

No EC number prediction in QRC95872.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	199	366	2.9e-41	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	3.28e-35	199	354	1	158	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC95872.1|CE5	1.93e-195	1	371	1	371
AWO14269.1|CE5	1.00e-166	1	371	1	369
CAE7205720.1|CE5	1.14e-118	1	371	1	377
CBX94902.1|CE5	1.28e-86	175	370	112	303
BAE58644.1|CE5	5.28e-61	189	370	34	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	3.30e-30	180	365	62	244	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
1CUZ_A	1.52e-16	196	354	27	192	Chain A, CUTINASE [Fusarium vanettenii]
5X88_A	5.46e-16	187	340	11	172	Chain A, cutinase [Malbranchea cinnamomea]
1XZJ_A	7.28e-16	196	354	27	192	Chain A, CUTINASE [Fusarium vanettenii]
1CUH_A	9.95e-16	196	358	27	196	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VJF5|CUTI4_EMENI	6.82e-49	190	370	50	223	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	9.37e-37	190	370	21	202	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|Q8X1P1|CUTI_BLUHO	5.59e-31	179	365	50	233	Cutinase OS=Blumeria hordei OX=2867405 GN=CUT1 PE=3 SV=1
sp|A8QPD8|CUTI1_TRIHA	7.48e-31	196	363	75	242	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	2.35e-30	190	369	21	200	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000347	0.999610	CS pos: 19-20. Pr: 0.8830

TMHMM  Annotations     

There is no transmembrane helices in QRC95872.1.