CAZyme Information: QRC95870.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC95870.1
• CAZy Family: CE1
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2F383]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776		87806.81	7.7422

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069028:133338-135814(+)

Full Sequence      

MRIGSWYLSWCHGHLAIKSSQCAGRSRSGKHSSLFPSQASVATFNSIMADGIVTTPETGS
SSADAVQPPRNTLAPAPDTIEPVASSPQNVLSSKDSTRSDVQPQNQPLRFVESSASSSGD
EIGPADGPSSAAPFKKSRHGKFAYSDRYEPGEYVIEQLSEYDDVDLVKPWQRKLILIHPI
VIVWVFLTYVAYYGYRVWCNYQFRVVYGGLAEASWIFIVVEGVILLPYLSWMAVLLLSLG
NRKRPKLRLRGEAVPTVDVLFTTCGEVVPMIINTVRGACNIDYPRDRYRIIICDDDADPN
LAEALQPLIAEYPNLVYQARVKVEGVPHHYKAGNLQSGIDYAVHLPGGPAEYLATLDADM
IPHPEWLRAILPHLLRDPELALVSPPQTFWNVPADDPLCQSICEFIHYLEPRKDHMGAAW
CTGSGVVFKRFIVDELGGWPTPSMAEDQLLSFMMNGAGYKTAYLHEFMQVGMVPESIINH
LKQRTRWAVGTLETAQELNWGLPGKYTKHMTFPQRWCIFTFAFNTIMAIPVFIAYFIIPA
LLYWGRDLLVYVTDDQLRWQIRLCAIWVVSLRINEIVLTLPSGYIQGQRSAMAWQFMTPY
LAVTILRCYILPTWLGGKKIAFLASGAIRDRLKERSEMHRAGLWTRIKLMGIHCRIWFFV
LFVPYCLGAAGLDWYRAYSQPSTNASLRHLLVNSMLPPMWWLFLAISFCIPILYVFRPPT
VPDRDDMMNFDQKTGAGQPKHQEIRQTWGFLPLVREVAWGLTVVYVLVLFVGTFVY

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	354	544	9.7e-17	0.9695431472081218
GT2	259	436	4.5e-16	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	2.97e-95	255	495	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	1.12e-38	210	624	9	423	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133059	CESA_CaSu_A2	7.79e-24	278	490	23	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
133057	CESA_NdvC_like	3.76e-22	270	490	13	227	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
236918	bcsA	3.14e-21	255	541	260	547	cellulose synthase catalytic subunit; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC95870.1|GT2	0.0	1	776	1	776
QDS68194.1|GT2	0.0	145	774	102	738
ATZ49458.1|GT2	3.22e-176	132	774	136	781
CCD45106.1|GT2	3.22e-176	132	774	136	781
APA12172.1|GT2	3.57e-173	144	774	150	785

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	2.64e-23	255	530	273	536	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
6YV7_B	5.20e-06	255	475	42	250	Mannosyltransferase PcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	5.22e-06	255	475	43	251	Mannosyltransferase PcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CW87|ACSA1_KOMXY	4.92e-23	255	549	149	431	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
sp|P37653|BCSA_ECOLI	1.34e-22	255	530	273	536	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
sp|Q8X5L7|BCSA_ECO57	1.76e-22	255	530	273	536	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
sp|Q8Z291|BCSA_SALTI	1.77e-22	241	530	259	536	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
sp|Q93IN2|BCSA_SALTY	4.06e-22	241	530	259	536	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000013

TMHMM  Annotations     

Start	End
174	196
216	238
516	538
592	611
656	678
698	717
753	775